KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_2349Help
Entry
BAMF_2349         CDS       T01321                                 

Gene name
efp
Definition
(GenBank) elongation factor P
  KO
K02356  elongation factor P
Organism
bao  Bacillus amyloliquefaciens DSM 7
Brite
Translation factors [BR:bao03012]
 Prokaryotic Type
  Elongation factors
   BAMF_2349 (efp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EFP_N Elong-fact-P_C EFP
Motif
Other DBs
NCBI-ProteinID: CBI43475
Position
complement(2406373..2406930)
Genome map
AA seq 185 aa AA seqDB search
MISVNDFRTGLTIEVDGGIWRVVDFQHVKPGKGAAFVRSKLRNLRTGAIQEKTFRAGEKV
AKAQIETKTMQYLYANGDQHVFMDTSSYEQLELNANQIEEELKYLLENMSVHIMMYQSET
LGIELPNTVELKVVETEPGIKGDTASGGTKPAKTETGLVVNVPFFVNEGDTLVVNTSDGS
YVSRA
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgatttcagttaacgattttcgtacaggactaacgattgaagtagacggcggcatttgg
cgcgtcgttgacttccagcacgtaaagccgggaaaaggagcggcatttgtccgttctaaa
ttgcgtaatctgcgtacgggcgctattcaggagaaaacattccgtgcgggtgaaaaagtg
gcgaaagcgcaaatcgaaacaaaaacgatgcagtatctttatgccaacggagatcagcac
gtgttcatggatacaagctcgtatgaacagcttgaattgaatgcaaaccaaatcgaagaa
gaattaaaatatcttctggaaaatatgtctgtacacatcatgatgtatcaatctgaaacg
ctcggtattgaactgccgaacacagttgaactgaaagttgttgaaacagagccgggaatt
aaaggcgatacggcgtcaggcggcacaaaacctgccaaaacggaaacaggtcttgtcgta
aacgtaccgttcttcgtgaacgaaggcgatacgcttgttgtaaatacatcagacggctct
tacgtgtcaagagcgtag

DBGET integrated database retrieval system