KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_2356Help
Entry
BAMF_2356         CDS       T01321                                 

Gene name
yqhM
Definition
(GenBank) putative lipoate protein ligase
  KO
K03800  
lipoate---protein ligase [EC:6.3.1.20]
Organism
bao  Bacillus amyloliquefaciens DSM 7
Pathway
Lipoic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bao00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00785 Lipoic acid metabolism
    BAMF_2356 (yqhM)
Enzymes [BR:bao01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.1  Acid-D-ammonia (or amine) ligases (amide synthases)
    6.3.1.20  lipoate---protein ligase
     BAMF_2356 (yqhM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(2411799..2412635)
Genome map
AA seq 278 aa AA seqDB search
MEKETWRFIDSGNESPAFNMALDEALLYWHSQKKIPPVIRFYGWNPATLSVGYFQNIKKE
INFDAVHKHGLGFVRRPTGGRGVLHDKELTYSVIVSEDHPEMPATVTEAYRVISEGILQG
FRNLGLDAYFAIPRTEKEKESLKNPRSSVCFDAPSWYELVVEGRKVAGSAQTRQKGVILQ
HGSILLDIDEDKLFDLFLYPSDRVRERMQRNFKNKAVAINALAQKPVTMDEARIAFKAGF
EEGLNIHLEPYTLTPEELAFVNELAETKYASDEWNYKR
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaagaaacatggcggtttattgactcagggaatgaaagcccggcatttaacatg
gcgctggatgaagcgcttttatattggcacagccaaaaaaaaattcctccggtgatccgt
ttttacggctggaatccggcaacgctgtctgtcgggtattttcaaaatattaagaaggaa
attaactttgacgcagtacataaacacggcctcgggtttgtcagaagaccgacaggcgga
cggggtgttctacatgataaagaattgacatacagcgtaatcgtttcagaggatcatccg
gaaatgccggccacggtgacagaggcataccgggtgatttcagaaggcattctgcagggg
ttcagaaaccttgggcttgatgcttactttgcgattccgcgtacggaaaaggaaaaagaa
agcctgaaaaatccgcgctcgtccgtctgctttgatgcgccttcgtggtatgagctggtc
gtcgaagggcggaaagtggcgggaagcgcgcagacacgccaaaaaggcgttattcttcag
cacggctccatcctgcttgacattgatgaggacaagctgtttgatctgtttttatatccg
agcgacagagtccgtgagcgcatgcagcggaatttcaaaaacaaagcggtagccatcaac
gccttagcgcaaaaaccggtaacgatggatgaagccagaatcgcttttaaagccggtttt
gaggaaggcctgaacattcatcttgagccttacacactcacgccggaagagcttgcgttt
gtcaatgagctggccgagacgaaatacgcgtctgacgaatggaattataagcgctga

DBGET integrated database retrieval system