KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_2357Help
Entry
BAMF_2357         CDS       T01321                                 

Gene name
yqhL
Definition
(GenBank) putative sulfur transferase
Organism
bao  Bacillus amyloliquefaciens DSM 7
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rhodanese
Motif
Other DBs
NCBI-ProteinID: CBI43483
Position
2412829..2413212
Genome map
AA seq 127 aa AA seqDB search
MSNMIALIIVAAFIVYMIVSYFYQQRLMKTLTEEEFRAGYRKAQLIDVREPNEFEGGHIL
GARNIPLSQLKQRKSEIRPDKPVYLYCQNNVRSGRAAQTLRKHGCKDIYNLKGGFKKWGG
KIKAKNQ
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
ttgtctaatatgattgctttaattattgttgcggcgtttatcgtttatatgatcgtgtcg
tatttttaccagcagcgtttaatgaaaacacttacggaagaggaattccgcgcgggctac
agaaaagcgcagctgattgacgtccgtgagccgaatgaatttgaaggcggccatattctc
ggcgcgcgtaacattccgctgtcacagctgaagcagcgcaaaagcgaaatccgtcctgat
aaacccgtttatctgtactgccaaaacaatgtccgcagcggacgcgcggcacagacgctc
cgcaaacacggctgcaaggatatttacaacctgaaaggcggatttaaaaaatggggcgga
aaaattaaagcaaagaaccaataa

DBGET integrated database retrieval system