KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_2399Help
Entry
BAMF_2399         CDS       T01321                                 

Gene name
pbpA
Definition
(GenBank) transpeptidase (penicillin-binding protein 2A)
  KO
K21465  
penicillin-binding protein A
Organism
bao  Bacillus amyloliquefaciens DSM 7
Pathway
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:bao00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BAMF_2399 (pbpA)
Peptidoglycan biosynthesis and degradation proteins [BR:bao01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   BAMF_2399 (pbpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(2445610..2447760)
Genome map
AA seq 716 aa AA seqDB search
MRRNKKKIAVNKEKKKSLPIRLNFLFLAAFLIFTWIIVELGIKQIVQGDDYKNAANKQEE
SDVSTAVPRGKIYDRNLNPIVTNKALNAITYTRSASTTQAQRLKIAKKLSGMIKVSTKKV
TERDKKDYWMLTRPDEAKKLITAKEKQKAEDKKLSDDDLYQLQLKRITDKQLNELTSKDM
QVLAIKRQMDSGYSLTPQYIKNEGVSAKEMAVVSEHLDELPGVDVTSDWERSYPNKGLLK
SVLGSVSSSNEGLPSNLLEHYLSLGYSRNDRVGKSYLEYQYENLLQGQKEKVRNVTDSSG
NVTDTETVTKGKAGDDLVLTIDTELQKDVEKIIEKNLRAAKARPSTQLLDRAFVVMMDPR
NGEVLTMAGKQIKQVNGKYKIDDYALGTMTSSYNMGSAVKGATLLTGYQTGAIKIGNIFT
DEVLNIKDSPPKKSVSVMGPINDLTALERSSNVYMFKTAIAIGKGKYISGHSLPLDYSAF
DKFRYYFSEFGLGVKTGIDLPNEATGYVGTKRQSGFLLDFAIGQFDTYTPLQMAQYVSTI
ANGGFRMKPQIVKEVRKPDSKKGIGAVVESVNPEVMNRLDMTESEIKRVQQGFKLVMQGA
QGTARANFANKSYNPAGKTGTAQAFYDGPIKSRTGASTYNTTLVAYAPADHPEVAISVVV
PWAYENYNDRYSITNDIGEAVLDKYFELKKKQEENNTKQKNEDKIQKDAENGNTNN
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atgaggagaaataaaaagaaaatagcagtaaacaaagaaaagaaaaaatcactgccgatc
cggcttaattttttgtttttggccgcgtttcttatttttacgtggattatcgtcgagctt
ggcatcaagcagatcgttcagggtgatgactataaaaacgccgccaacaagcaagaggag
tctgatgtcagcacggcggttccgagagggaaaatatacgaccggaaccttaatcccatc
gtaacgaataaagcattaaatgcgattacatatacacgttcagcctcaaccacccaggcg
cagcgtttaaaaatcgcaaaaaaattgtctggtatgattaaggtaagcaccaaaaaggtg
actgaacgggacaaaaaagactattggatgttaacgaggcctgatgaggcaaaaaaactg
attacggcaaaagaaaagcaaaaagctgaggacaaaaagctgtctgacgatgatttatac
cagcttcagctgaaacggatcacggacaaacagctgaacgaactcacttcaaaagatatg
caggtccttgcgatcaaaaggcagatggattcaggctactcactgactcctcaatacatc
aaaaatgaaggtgtgtcggctaaagaaatggccgtcgtcagcgaacatttagatgaactg
ccgggggttgacgtgacgtctgactgggaacggtcttatccaaataaaggattattaaaa
tcagttctcggcagtgtctcgagttccaatgaagggctcccttcaaaccttcttgaacat
tatttgtcgctaggctatagcaggaatgacagggttggaaaaagttatttagagtatcaa
tatgaaaatctgctccagggacaaaaagaaaaagtgagaaacgtaactgactcctctgga
aacgtgacagatactgaaacggttacaaaaggtaaagccggtgacgatttagtgctcacc
atagataccgaattgcaaaaagacgttgaaaaaattattgagaaaaatttaagagcggca
aaggcaagaccaagtacacagctgcttgacagggcatttgtcgtaatgatggacccgcgc
aacggagaagtgcttacaatggcgggcaaacaaattaaacaagtaaacggtaaatataaa
attgatgattatgcactaggaacaatgacgtcttcttataacatgggttcagctgtaaaa
ggagcaacgctgttaactggttatcagacaggtgctataaaaatcgggaatatctttacg
gacgaagttttgaatattaaagattcccctcctaaaaagtcggtaagtgtgatgggaccg
ataaatgatttaacagctcttgagcgttcctctaacgtatatatgtttaaaactgcgatt
gcgattggtaagggtaaatatatatcggggcattcattgccgcttgattacagcgcattc
gataaatttcgttattacttcagtgaattcggtttaggtgtaaaaacgggcattgatctt
ccgaatgaagcgacaggatatgtgggaactaaaagacagtcagggttcctgcttgacttt
gcgatcggacaatttgacacatatacaccgcttcaaatggctcagtatgtatcgaccatt
gccaatggaggctttcgtatgaaacctcaaatcgtaaaagaagtacgaaagcctgattct
aaaaaaggtatcggagccgttgttgaatcggttaacccggaagtaatgaaccgcctcgat
atgacggaaagtgaaattaaacgtgttcagcaaggttttaagcttgttatgcaaggcgct
caaggtactgcaagagcaaattttgctaataaaagttataaccctgctggtaaaacggga
accgcacaggccttctatgatggtcctataaaatcaagaaccggcgcgtctacttacaac
acaacacttgtagcttatgcgcctgcagatcatcctgaagttgccatttcggtcgtagtt
ccatgggcttacgaaaattacaatgacagatattctatcaccaatgacattggggaagcg
gtactagacaaatacttcgagctgaaaaagaagcaagaagaaaataatacgaagcagaaa
aacgaagataaaatccagaaagacgctgaaaacggcaatacaaataactga

DBGET integrated database retrieval system