KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_2409Help
Entry
BAMF_2409         CDS       T01321                                 

Gene name
yqfU
Definition
(GenBank) putative integral inner membrane protein
Organism
bao  Bacillus amyloliquefaciens DSM 7
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YitT_membrane DUF2179 Ribosomal_L14
Motif
Other DBs
NCBI-ProteinID: CBI43535
Position
complement(2454782..2455663)
Genome map
AA seq 293 aa AA seqDB search
MTPNKQHKRESFLHFIFRVILILVGAGSAAASIELFLVPNNVIDGGIIGVSLILDHLFMS
NPILNFALFVVLLNIPFMIFGYKYIGKTFLISTVIGIVGLALIESSLHHVEAITTQPILA
TVFGGLLLGFGVGLVIRNGGSMDGTEILGILLTKKLPFSVGEFVMLINVFIFIWAGFVYG
PEQAMYSFMTYYIAMKTIDAVIQGLDETKAVIIVADQYAEISDAILHRLGRGTTKLQGKG
GYTDESKEVIYAVVTRLEVTKLKSIVFEIDKNAFITIMNTHETRGGKFKTAIH
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgaccccaaataaacagcataaaagagagtcatttttacactttatcttcagggtcatc
ttgattctggtcggagcgggctcagccgccgcaagtattgaattgtttctggtcccaaat
aatgtgatcgacggaggaattatcggtgtttcattaattttagaccacctctttatgtcc
aatcccatcctcaatttcgccttattcgttgtgttactcaacattccatttatgattttc
gggtataaatatatcggaaaaacatttctcatctctacggttatcgggatcgtcggttta
gcgctgattgaatcctcattgcatcatgtggaggccattacgacccagcctattttggcg
acggtattcggggggcttttgctcggtttcggggtaggccttgtcatccgaaacggaggc
tcgatggacggtactgagatcctcggtatccttctcacaaaaaagctgcccttttcagtc
ggagaattcgttatgctcattaatgtgtttatttttatttgggccggttttgtatacggg
ccggagcaggcgatgtattctttcatgacttattatattgccatgaagacgattgacgcc
gtcatccagggtcttgatgaaacgaaagcggtcattattgtagccgaccagtacgcggaa
atttcagacgcgattttgcaccggcttggacggggcaccaccaagcttcagggaaaaggc
ggatatacggatgaatccaaagaagtcatttacgcggtcgtgacaaggcttgaagtgaca
aaattgaaatccattgtgtttgaaattgataaaaacgcatttattacgatcatgaataca
catgaaacgaggggcggtaagttcaaaaccgcgattcactag

DBGET integrated database retrieval system