KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_2431Help
Entry
BAMF_2431         CDS       T01321                                 

Gene name
phoH
Definition
(GenBank) phosphate starvation-induced protein
  KO
K06217  
phosphate starvation-inducible protein PhoH and related proteins
Organism
bao  Bacillus amyloliquefaciens DSM 7
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(2477184..2478143)
Genome map
AA seq 319 aa AA seqDB search
MAEHLLAMNHKLKSPDEALSLFGSQDAFLHLMEKDLGVSIITRGETIYVSGNDESFEIAD
RLLGSLLTLIRKGIEISERDVLYAVKMAKKDELDYFESMYEEEITKTAKGKPIRVKTLGQ
REYVAAMKKNDMVFGIGPAGTGKTYLAVVKAVHALKNGHIKKIILTRPAVEAGESLGFLP
GDLKEKVDPYLRPLYDALHDVLGSDHTERLMERGVIEIAPLAYMRGRTLDDAYVILDEAQ
NTTPAQMKMFLTRLGFGSKMIITGDVSQIDLPKGVTSGLAVARDMLKDINGISVIELDQT
DVVRHPLVAKIIEAYDKQK
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atggcagaacatttacttgcgatgaatcacaaactgaaaagcccggacgaagcactttct
ttgttcggcagccaagacgcctttttacatttgatggagaaggatctgggcgtaagcatc
atcacacgcggtgaaaccatttacgtttccggcaatgatgagtcttttgagattgctgac
agattattgggctcgctccttactttaattcgcaaggggatcgagatttcggaacgtgat
gtgctgtatgccgtgaaaatggcaaagaaagatgaactggactattttgaaagcatgtat
gaagaagaaataacgaaaacggcaaaaggcaaaccgatccgtgtcaaaaccctcggccag
agagaatatgtcgcggcgatgaagaaaaacgacatggtgttcggcatcgggccggcggga
accggcaaaacatatttggcggtcgtaaaagcggtgcatgctttaaaaaacggccacatt
aaaaaaatcattttaacaagacccgctgtggaagccggcgagagcctcggttttctgccc
ggagatttaaaggaaaaagtagatccttacctgcgcccgctgtatgacgcgctccatgat
gtgctcggaagcgaccatacggaacgtcttatggaaagaggggttatcgaaatcgccccg
ctcgcctatatgagagggcggacgcttgacgacgcgtatgtgattcttgatgaggcccag
aataccacccccgctcaaatgaaaatgtttttgacgagattgggttttggctctaaaatg
atcattacgggcgacgtaagccaaattgacctgccgaaaggcgtcacatcgggacttgca
gtagcgagggatatgctgaaggacataaacggcatttccgtgattgaacttgaccagaca
gatgtggtcagacatccgcttgttgcaaaaattattgaagcttatgataagcaaaagtaa

DBGET integrated database retrieval system