KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_2448Help
Entry
BAMF_2448         CDS       T01321                                 

Gene name
lepA
Definition
(GenBank) ribosomal elongation factor, GTPase
  KO
K03596  GTP-binding protein LepA
Organism
bao  Bacillus amyloliquefaciens DSM 7
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU LepA_C EFG_C GTP_EFTU_D2 EFG_II MMR_HSR1 SRPRB RF3_C Ras PduV-EutP MMR_HSR1_Xtn
Motif
Other DBs
NCBI-ProteinID: CBI43574
Position
complement(2493594..2495429)
Genome map
AA seq 611 aa AA seqDB search
MTDKEKRLERQSRIRNFSIIAHIDHGKSTLADRILEKTSAITQREMKEQLLDSMDLERER
GITIKLNSVQLKYKAKDGEEYIFHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEA
QTLANVYLALDNDLEILPVINKIDLPSAEPERVRQEVEDVIGLDASDAVLASAKAGIGIE
DILEQIVEKVPAPAGDPEAPLKALIFDSLYDAYRGVVAYIRVVEGTVKPGQKIKMMATGK
EFEVIEVGVFTPKAQPADELTVGDVGYLTAAIKNVGDTRVGDTITSAVKPAAEALPGYRK
LNPMVYCGLYPIDTAKYNDLREALEKLELNDSSLQYEAETSQALGFGFRCGFLGMLHMEI
IQERIEREFKIDLITTAPSVIYDVYMTDGEKIIVDNPSNMPDPQKIERVEEPYVKATMMV
PNDYVGAVMELCQGKRGNFIDMQYLDANRVSIVYEMPLAEIVYEFFDQLKSSTKGYASFD
YELIGYKPSKLVKMDIMLNAEKIDALSFIVHRDYAYERGKVIVEKLKELIPRQQFEVPVQ
AAIGQKIVARSTIKAMRKNVLAKCYGGDISRKRKLLEKQKEGKRRMKQVGSVEVPQEAFM
AVLKMDDSPKK
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
gtgacagataaagaaaagcgtttagagaggcagtcaagaatccggaatttctccatcatc
gcccatatagaccacggcaaatcgaccttggcggatcggattttagaaaaaacatcggcg
atcacccagcgggaaatgaaagaacaattgcttgattcaatggaccttgaacgcgaacgg
ggaattaccatcaaattaaattccgttcagctgaaatacaaagcaaaagacggagaagaa
tatatattccatctcatcgacacgcccggacacgtcgactttacatatgaagtttcgcga
agcctggctgcctgtgaaggcgcgattctcgttgttgatgcggctcagggaatagaagcg
cagacattggcgaacgtctatctggcgcttgataatgatcttgagattcttcctgtcatt
aataaaatcgatcttccgagcgcagagccagaacgtgtgcgtcaagaggttgaggacgtt
atcggccttgacgcttcagacgccgtcctcgcttcagcgaaagcgggcatcggcatcgaa
gacattttagaacagatcgtagaaaaagtgccggctcccgcgggagatccggaagctccg
ctgaaagcgctcatctttgactcgctttatgacgcgtaccgcggagtcgtcgcgtatatc
agagtcgtagaaggaacggtcaaaccgggccagaaaattaaaatgatggcaaccggaaaa
gagtttgaagtcattgaagtcggcgtctttacgccgaaagcgcagccggctgacgaattg
acagtcggtgacgtaggctatttgacagccgcaatcaaaaacgtcggcgacacccgtgtc
ggtgatacgatcacgagcgcggttaagcctgcggcagaagcgcttccgggctaccgcaaa
ctcaatccgatggtatactgcggactttatccgattgacacagccaaatataatgatttg
cgcgaagctctggaaaaacttgaattgaacgattcatctcttcaatacgaggcggagacg
tcacaagccctcggcttcggtttccgctgcggttttttaggaatgcttcacatggaaatc
attcaagagcggattgaacgggaatttaaaattgaccttattacgaccgcgccgagcgtt
atttatgacgtttatatgacggacggcgaaaagatcatcgtggataacccgtcaaacatg
cctgacccgcaaaaaatagagcgggtggaagaaccttatgtcaaagcgacgatgatggtt
ccgaacgattacgtcggagcggttatggagctttgccaggggaaacggggcaactttatc
gatatgcagtacttagacgccaaccgggtcagcattgtatatgagatgcctcttgcggaa
atcgtatatgaattttttgatcagctgaaatccagcacgaaagggtacgcctctttcgat
tacgagctgatcggctacaaaccgtccaaactcgtcaaaatggacattatgctgaatgca
gaaaaaattgatgcgctgtcatttatcgtgcaccgcgattacgcatacgagcgcgggaaa
gtcatcgtcgaaaaattgaaagaattgattccccgccagcaattcgaagtgcccgtacag
gcagcgatcggacagaaaatcgtggcccgctcaaccattaaggccatgcggaaaaacgtc
cttgcaaaatgttacggaggagacatctcgcggaaacggaagcttcttgaaaaacaaaaa
gaaggaaaacgccggatgaagcaggtcggctcggtagaagtgccgcaggaagcgtttatg
gccgttcttaaaatggatgacagcccgaaaaaataa

DBGET integrated database retrieval system