KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_2459Help
Entry
BAMF_2459         CDS       T01321                                 

Gene name
yqeM
Definition
(GenBank) conserved hypothetical protein
Organism
bao  Bacillus amyloliquefaciens DSM 7
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_31 Methyltransf_23 Methyltransf_11 Methyltransf_12 Ubie_methyltran NodS CMAS MTS MetW TPMT TehB N2227 Methyltransf_8 RrnaAD Methyltransf_15 DREV WXG100 adh_short MethyltransfD12 Methyltransf_32
Motif
Other DBs
NCBI-ProteinID: CBI43585
Position
complement(2504750..2505487)
Genome map
AA seq 245 aa AA seqDB search
MIYQGFAGVYDELMSHAPYDEWAGWIEASLPEKGRVLDLACGTGEISIRLAEKGCEVTGI
DLSEDMLSCAQQKKTGKPILFLQQDMRKLSGFEEQFDAVVICCDSLNYLKTKNDVLSTFK
SVFQVLKEGGLLLFDVHSPYKMTELFPDSTHADQDEQISYIWQSFAGDEELSVIHDMSFF
VWNGQSYDRYDETHEQKTFYIEEYKQMLAETGFELKKVTADFTDRPPSTESERLFFTAGK
PKTIV
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgatttaccaaggcttcgccggtgtatatgacgagttaatgtcacatgcgccgtatgat
gaatgggcgggctggatcgaagcgtctcttccggaaaagggaagggtgcttgatcttgcc
tgcggaaccggagaaatatccatcaggcttgctgaaaaaggctgcgaagtcacggggatt
gatttgagtgaagatatgctgagctgtgcccagcagaaaaaaacgggaaagccgattctt
tttctccagcaggatatgagaaagctttccggttttgaagaacagtttgatgccgtagtc
atctgctgtgattccctaaattacttaaaaacgaaaaatgatgtcttaagcaccttcaaa
agtgtttttcaagttttgaaggagggcggcctgcttctgtttgacgtccattccccgtat
aaaatgacggagctttttccggacagcacccatgcggatcaggatgagcagatcagctat
atctggcaaagctttgccggcgatgaagagctttctgtcatccatgatatgtcctttttc
gtatggaacggacaatcttatgaccgctatgacgagacgcatgagcaaaaaacattttac
attgaagaatataaacaaatgcttgcagagaccggatttgaactgaagaaggtgacggct
gattttacagaccggcctccttcaacagagtctgaacgtcttttctttacggcaggcaaa
ccaaaaaccatcgtttaa

DBGET integrated database retrieval system