KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_2464Help
Entry
BAMF_2464         CDS       T01321                                 

Gene name
aroD
Definition
(GenBank) shikimate 5-dehydrogenase
  KO
K00014  
shikimate dehydrogenase [EC:1.1.1.25]
Organism
bao  Bacillus amyloliquefaciens DSM 7
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:bao00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BAMF_2464 (aroD)
Enzymes [BR:bao01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.25  shikimate dehydrogenase
     BAMF_2464 (aroD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(2507272..2508114)
Genome map
AA seq 280 aa AA seqDB search
MKQLYGVIGNPIGHSMSPDIHNAALQDKNINGQYFAFQVEPRHLKDAVNGIKALGICGVN
VTVPHKVAIMEHLDEIHESAKVLGAVNTVKREGDRLIGYNTDGDGFYKSLVKVLDKPISE
LSILMIGAGGAARAIFTTIVRREPKQFDVCNRTPEKAESLIAAAPSFQQKRALTLKEAEN
QLEQYDVIIHTTSVGMYPKTDAVPLSLERAKTGAIVCDIVYNPIQTAFLKEAEKRGLTTL
DGVGMFVEQAALSFKLWTEQEPDSSLMRAIVEGKLGGTQC
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaattgtacggagtaatcggaaatccgatcgggcattcaatgtcacccgatatt
cataacgcagctttgcaagataagaacatcaacgggcagtattttgcgtttcaggtggaa
cctcgtcatctcaaggacgccgttaacggaatcaaggcgcttggcatctgcggagtgaac
gtcacagtcccgcataaagtcgcgatcatggagcatctggatgaaatacatgaaagcgcg
aaagtactcggggccgtaaataccgtcaaaagagagggagacaggctcatcgggtataat
actgacggagatgggttttataaatccttagtcaaagtattggacaaaccgatatcagag
ctctccatcctcatgattggggcgggaggagcggcaagagcgatttttacgacgatcgtc
cgcagagagccgaaacaatttgacgtttgcaaccgcacgccggaaaaagcagaaagtctg
attgctgctgctccctcttttcagcagaaacgcgcccttactttaaaagaagctgaaaat
cagcttgaacaatatgacgtcattattcatacaacatctgtcggcatgtatccgaaaacg
gatgccgtgccgctctcattggaacgggccaaaacgggcgccatcgtttgtgatatcgta
tacaacccgattcaaacggcgttcttaaaagaagctgaaaaaagaggtttaacaaccctt
gacggtgtcggcatgtttgtggaacaggctgcactgtctttcaagctgtggacggaacaa
gagcctgacagcagcttaatgagagcaattgttgaaggaaaactaggaggaacacaatgt
taa

DBGET integrated database retrieval system