KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_2472Help
Entry
BAMF_2472         CDS       T01321                                 

Gene name
spoIIIC
Definition
(GenBank) RNA polymerase sporulation-specific sigma-K factor precursor (Sigma-27) (C-terminal fragment)
  KO
K03091  
RNA polymerase sporulation-specific sigma factor
Organism
bao  Bacillus amyloliquefaciens DSM 7
Brite
Transcription machinery [BR:bao03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Sigma factors
     BAMF_2472 (spoIIIC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
2515157..2515879
Genome map
AA seq 240 aa AA seqDB search
MTGVFAALGFIVKELVFLVSYVKNNAFPQPLSNSEEKKYLDLMAEGDEHARNMLIEHNLR
LVAHIVKKFENTGEDAEDLISIGTIGLIKGIESYSAGKGTKLATYAARCIENEILMHLRA
LKKTKKDVSLHDPIGQDKEGNEISLIDVLKSESEDVIDTIQLNMELEKVKKYIDILDDRE
KEVIVGRFGLDLKKEKTQREIAKELGISRSYVSRIEKRALMKMFHEFYRAEKEKRKKKGK
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
gtgacaggtgtttttgcagcgctcgggtttattgtgaaagaactcgtgtttttagtatca
tacgtgaaaaataatgcctttccacaaccgctctcaaatagtgaggagaaaaaatactta
gaccttatggccgaaggagatgaacacgcccgcaatatgctgatcgaacataatctccgt
ttagtcgcccatattgtaaaaaaattcgaaaacacgggagaagacgcagaagatctgatc
tccatcggtacaatcgggctgatcaaaggaattgaaagctactcagccggaaaaggcacg
aagcttgccacatatgccgcacgatgtattgagaatgagattttaatgcatctgcgcgca
ttgaaaaaaacgaaaaaagacgtctcccttcatgacccgatcggccaggataaagaaggg
aatgaaataagcctgattgatgttctcaagtcggaaagcgaagatgtgatcgacaccatt
cagctcaacatggaacttgaaaaggtcaaaaaatatattgatattttagacgaccgcgaa
aaagaagtcatcgtcggccgcttcgggcttgatttaaaaaaagaaaaaacgcagcgcgag
atcgcaaaggagctcggcatttcaaggagttatgtgtcgcggattgaaaaacgcgcattg
atgaagatgtttcatgagttttaccgggcggaaaaggagaagcggaagaagaagggaaag
tga

DBGET integrated database retrieval system