KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_2473Help
Entry
BAMF_2473         CDS       T01321                                 

Gene name
spoIVCA#
Definition
(GenBank) site-specific DNA recombinase
Organism
bao  Bacillus amyloliquefaciens DSM 7
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Resolvase
Motif
Other DBs
NCBI-ProteinID: CBI43599
Position
complement(2516012..2516149)
Genome map
AA seq 45 aa AA seqDB search
MLQYAVDGFSAELLERPALNGLREDASKGLISQVICYDPDRLSRK
NT seq 138 nt NT seq  +upstreamnt  +downstreamnt
gtgctgcagtatgccgttgatggattttctgcggagcttttagaacgtccggcgttgaat
ggcctgagggaggatgcaagcaagggacttattagtcaagtcatctgctacgatcctgac
cgtctttctcggaaatag

DBGET integrated database retrieval system