KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_2558Help
Entry
BAMF_2558         CDS       T01321                                 

Gene name
yrrC
Definition
exonuclease
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
bao  Bacillus amyloliquefaciens DSM 7
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bao00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BAMF_2558 (yrrC)
Enzymes [BR:bao01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     BAMF_2558 (yrrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2601216..2603594)
Genome map
AA seq 792 aa AA seqDB search
MDQLKIEEQPYVKGVIHTVIYHNDTNLYTVLKVKVAETSEAIEDKVVSVTGYFPLLQEDE
TYTFYGKTATHPKFGLQFQAEHFKKEIPTTKEGIIHYLSSDLFEGIGKKTAEEIVKKLGD
GALNKILADASVLYDVPKMSKKKADKLAGELQRHQGLEQIMISLNQYGFGPQLSMKIYQA
YETETLEKIQENPYQLVKDVEGIGFVKADELGEKMGLSGNHPERIKAAILYTIESTCLSE
GHTYIDTKQLIINTQTLLNQSADGGRVTEMDAADGIIALGESKDIVIEGDRCYFPSLFYA
EQNVAKRVLDIAAQTEYADQFPESEFLLALGELEERMKVQYAPSQKDAIQKALSSPMLLL
TGGPGTGKTTVIKGIVELYSELHGVSLDPGDYKKDEAFPVLLAAPTGRAAKRMSESTGLP
AVTIHRLLGWNGAEGFTYNEDQPIEGKLIIIDEASMLDIWLASHLFKALPKHIQLIVVGD
EDQLPSVGPGQVLRDLLASEVLPTVRLTDIYRQAEGSSIVELAHDMKKGLLPKGLTAPTK
DRSFIRCNSAQIKEVVDQVVSNALKKGYTSRDIQVLAPMYRGKAGINELNMLLQDIMNPP
KEKRRELKFGDVVYRTGDKILQLVNQPENNVFNGDIGEIVSIFYAKENTEKEDMVVVSFD
GNEITFTKKDFSQFTHAYCCSIHKSQGSEFPIVVLPVVKGYYRMLRRNLLYTAITRAKKF
LILCGEEEALEWGVKNNDATVRQTSLKNRLTEQTEEMDAELAALQKELPFSVYDANIGME
GITPFDFMEEKA
NT seq 2379 nt NT seq  +upstreamnt  +downstreamnt
gtggatcagctgaaaatcgaggaacaaccgtatgtaaaaggcgttattcatacggtcatt
taccacaatgacaccaacctgtatacagtgctgaaggtcaaggttgcagaaacgtctgag
gcgatcgaagacaaggtcgtatccgtaacgggctacttccctctgctgcaagaagatgag
acttacacattttacggaaaaaccgccacacaccccaagttcggcctgcaattccaggct
gaacactttaaaaaagaaattccgaccacaaaagaagggattattcactatttatcaagc
gatctgtttgaaggaatcggaaaaaaaacggcggaagaaatcgtcaaaaagcttggagac
ggcgcgctgaataaaattctggctgatgcgtcggtgctttacgatgtgccgaaaatgtcc
aaaaagaaagcggataagcttgccggagagctgcagcggcatcaggggctggagcagatt
atgatttctcttaaccaatatggtttcggacctcagctttccatgaaaatttatcaggct
tacgaaacggaaacccttgagaaaattcaggagaatccttatcagcttgtaaaggacgtg
gaaggcatcggctttgtaaaagccgacgagctgggcgaaaaaatgggtctgtcagggaac
catcccgagcggatcaaagcggcgatcttatatacgattgaatcgacctgcctttcagaa
ggtcatacgtacatagacacaaagcagctgattatcaatacgcaaacgcttctgaatcag
tcagctgacggaggccgggtcacggaaatggatgcggctgacggcatcatcgccctcgga
gagagtaaggacatcgtcatagaaggagaccgctgctattttccgtctttgttttacgcg
gaacaaaatgtcgcaaaacgcgtgctcgacattgcggctcagacggagtatgccgatcaa
tttcctgaatcggaatttctgcttgcgctcggcgaactggaagaacggatgaaagttcaa
tacgctccgagtcaaaaggatgccattcaaaaagcgctgtcttcgccgatgcttttactg
accggaggaccgggtacgggaaaaacgaccgttatcaaaggaatcgtggaattatacagt
gaactccacggcgtatcgcttgatcccggtgattataaaaaagacgaggcgtttccggtg
ctgcttgccgcgccgaccggaagagccgcaaaacggatgagcgaatctacgggtctgcct
gctgttacgattcacaggctgctcggctggaatggcgctgaaggctttacctacaatgaa
gatcagccgattgaagggaaactgatcattatagacgaagcgagtatgctcgatatttgg
ctcgccagccatttgtttaaggcgctccctaagcacatccagctcatcgtcgtgggtgat
gaagaccagcttccttccgtggggccggggcaggtgctgagagaccttttggcttctgag
gtgctgccgaccgtgcgtctgacagatatttaccgtcaggcggaagggtcatccatcgtc
gaacttgcccatgatatgaaaaaagggctgcttccaaaaggactgaccgcgccgacaaaa
gaccgctcatttatccgctgtaattctgcacagattaaagaagtcgtcgatcaagtcgtt
tcaaacgcgttaaagaagggatatacctccagagatattcaagtgcttgcgccgatgtac
aggggaaaagcgggaattaacgagctgaatatgcttcttcaagacatcatgaatccgccg
aaagaaaaaaggcgggagctgaaattcggagatgtcgtctacaggacgggcgataaaata
ttgcagcttgtcaaccagccggaaaacaatgtgtttaacggtgatatcggcgaaatcgtg
tccattttttatgccaaagaaaatacggaaaaagaagacatggtcgtcgtctcgtttgac
ggcaatgaaatcacctttacgaaaaaggatttcagccagtttacccatgcttactgctgt
tccatccacaagtctcagggaagtgaatttccgattgtcgtcctgcctgttgtcaaaggc
tactatcgaatgcttaggagaaatctcctttataccgccattacaagggccaagaaattt
ctgatcctttgcggagaagaagaagcgcttgaatggggcgtcaaaaacaatgatgccacc
gtcagacagacgtcgcttaaaaacaggctcacagagcagactgaagagatggatgcagaa
ctggccgctctgcaaaaagaactgccgttcagtgtatatgatgcgaatatcggaatggaa
ggcattacgccgtttgactttatggaagaaaaagcgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system