KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_2621Help
Entry
BAMF_2621         CDS       T01321                                 

Gene name
hemD3
Definition
uroporphyrinogen III cosynthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
bao  Bacillus amyloliquefaciens DSM 7
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:bao00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2663613..2664395)
Genome map
AA seq 260 aa AA seqDB search
MANDLPLQGKTVLVTRNKRQAAPFRKKVEALGGTAVSASLIAFQEALPGECADSLREDLS
EPGWLVFTSVNGVRFFFSYLDEHGLALSGRKKIAAVGEKTARALKERGAGTDAMPDEYVA
ECLADTLKRHASAAEPISVIKGNLSRDVIKAELEPLGYQIREWVLYNTIQDEKGMDELRQ
AASRSHFDFITFTSSSAVHTFMHAVGDEKKTLENSGASYISIGPLTEKALLEYGISSHVP
DTYTIEGMLDVMCSMSGKDR
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatgaccttcctttacaaggaaagaccgtgcttgtcacccggaacaaaagacag
gccgccccgttccgaaaaaaagtggaggcgctcggcggaacggctgtttccgcttcgctg
atcgcttttcaggaagcgctcccgggtgaatgtgcggacagtctccgggaagacctttct
gagccggggtggcttgtttttacaagcgtaaacggtgtccggttctttttttcctacctc
gatgagcacggccttgcgctttcgggacggaaaaaaatcgcagccgtcggtgaaaagact
gcgcgcgcccttaaagagcggggagccgggacggatgcgatgcctgatgagtatgtggct
gaatgtctggctgatacattaaagcggcacgcatcagctgccgaacccatttcagtgata
aagggcaatttatcacgcgatgtcataaaagcggagcttgagccgcttggctatcaaata
agggaatgggtgctgtacaataccattcaggatgaaaaaggaatggacgagctgagacag
gctgcatcccgctctcattttgattttattacgtttaccagttcttcggcggtgcatacg
tttatgcatgcggtcggagacgaaaaaaaaactttggaaaacagcggtgcgagctatatc
agcatcggccctttgacggaaaaagcgctattggaatacgggatctcatcccatgtgcct
gacacctatacgattgaaggcatgctggacgtcatgtgcagcatgtcgggaaaggataga
taa

DBGET integrated database retrieval system