KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_2659Help
Entry
BAMF_2659         CDS       T01321                                 

Gene name
fadB
Definition
hypothetical protein
Orthology
K13767  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bao  Bacillus amyloliquefaciens DSM 7
Pathway
Fatty acid degradation
Metabolic pathways
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bao00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    BAMF_2659 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    BAMF_2659 (fadB)
Enzymes [BR:bao01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BAMF_2659 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2704283..2705062)
Genome map
AA seq 259 aa AA seqDB search
MNSLSVAVEQSIAVITIDHQPANALSGAILDELSGLFDRYETDDSVRSIIIRGEGKFFSA
GADIKEFTSLENLEQSSAMADKGQQLMEKIEGFPKPVIAAIHGAALGGGLELAMACHIRI
ATLDAKLGLPELNLGIIPGFAGTQRLPRYVGTAKALEMIGTSEPVTGKEALSLGLVTIGA
ENEEELLQKAKTLAGKFAEKSPQSMASLLELLYTNKVYSYDGGLKLEAKRFGEAFASDDA
KEGIQAFLEKRKPQFGGRR
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgaacagcctttcagtggcggtagaacaatctatcgcggtgatcaccattgatcatcag
ccggccaacgcgctgtccggtgcgattttagacgaattgtccggtctgttcgaccggtat
gaaacagatgacagcgtcagaagcatcatcattcgcggtgaggggaaatttttctcggcg
ggcgccgatataaaggaatttacgtcgcttgaaaatcttgagcagtcttctgccatggcg
gataaaggccagcagctgatggaaaaaattgaagggtttccgaagcctgttatcgcagcg
attcacggcgctgcgcttggcggcggtctggagcttgccatggcctgtcatatcagaatc
gctacattggatgcaaagctcggcctgcccgagctgaatctcggcattatcccgggcttt
gccgggacgcagcgtctgccccggtacgtcggcacggcgaaagcgcttgaaatgatcggc
acgtcagaacctgtgaccggaaaagaagcgctcagcctcgggcttgtcaccataggcgcc
gaaaatgaggaagagctgctgcaaaaggcgaaaacactcgcaggcaagtttgcggaaaaa
agcccgcagtcgatggcttccctgcttgagctcctttatacaaacaaggtttattcttat
gacggcggcttaaagcttgaagcaaagcgctttggggaagcatttgcatcagatgacgca
aaagaaggcattcaggcatttctcgaaaaaagaaagcctcaattcggtgggcgaagataa

DBGET integrated database retrieval system