KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_2659Help
Entry
BAMF_2659         CDS       T01321                                 

Gene name
fadB
Definition
hypothetical protein
Orthology
K13767  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bao  Bacillus amyloliquefaciens DSM 7
Pathway
Fatty acid degradation
Metabolic pathways
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:bao01212]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:bao00071]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2704283..2705062)
Genome map
AA seq 259 aa AA seqDB search
MNSLSVAVEQSIAVITIDHQPANALSGAILDELSGLFDRYETDDSVRSIIIRGEGKFFSA
GADIKEFTSLENLEQSSAMADKGQQLMEKIEGFPKPVIAAIHGAALGGGLELAMACHIRI
ATLDAKLGLPELNLGIIPGFAGTQRLPRYVGTAKALEMIGTSEPVTGKEALSLGLVTIGA
ENEEELLQKAKTLAGKFAEKSPQSMASLLELLYTNKVYSYDGGLKLEAKRFGEAFASDDA
KEGIQAFLEKRKPQFGGRR
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgaacagcctttcagtggcggtagaacaatctatcgcggtgatcaccattgatcatcag
ccggccaacgcgctgtccggtgcgattttagacgaattgtccggtctgttcgaccggtat
gaaacagatgacagcgtcagaagcatcatcattcgcggtgaggggaaatttttctcggcg
ggcgccgatataaaggaatttacgtcgcttgaaaatcttgagcagtcttctgccatggcg
gataaaggccagcagctgatggaaaaaattgaagggtttccgaagcctgttatcgcagcg
attcacggcgctgcgcttggcggcggtctggagcttgccatggcctgtcatatcagaatc
gctacattggatgcaaagctcggcctgcccgagctgaatctcggcattatcccgggcttt
gccgggacgcagcgtctgccccggtacgtcggcacggcgaaagcgcttgaaatgatcggc
acgtcagaacctgtgaccggaaaagaagcgctcagcctcgggcttgtcaccataggcgcc
gaaaatgaggaagagctgctgcaaaaggcgaaaacactcgcaggcaagtttgcggaaaaa
agcccgcagtcgatggcttccctgcttgagctcctttatacaaacaaggtttattcttat
gacggcggcttaaagcttgaagcaaagcgctttggggaagcatttgcatcagatgacgca
aaagaaggcattcaggcatttctcgaaaaaagaaagcctcaattcggtgggcgaagataa

DBGET integrated database retrieval system