KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_2722Help
Entry
BAMF_2722         CDS       T01321                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bao  Bacillus amyloliquefaciens DSM 7
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:bao00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BAMF_2722 (pfkA)
   01230 Biosynthesis of amino acids
    BAMF_2722 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAMF_2722 (pfkA)
   00030 Pentose phosphate pathway
    BAMF_2722 (pfkA)
   00051 Fructose and mannose metabolism
    BAMF_2722 (pfkA)
   00052 Galactose metabolism
    BAMF_2722 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    BAMF_2722 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    BAMF_2722 (pfkA)
Enzymes [BR:bao01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BAMF_2722 (pfkA)
Protein phosphatases and associated proteins [BR:bao01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     BAMF_2722 (pfkA)
Messenger RNA biogenesis [BR:bao03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     BAMF_2722 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2773137..2774096)
Genome map
AA seq 319 aa AA seqDB search
MKRIGVLTSGGDSPGMNAAVRAVVRKAIYHDVEVYGIYNGYSGLISGKIEKLELGSVGDI
IHRGGTKLYTARCPEFKTVEGREKGIENLKKLGIEGLVVIGGDGSYMGAKKLTEHGFPCV
GVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWA
GLAGGAESILIPEADYDMEEIIGRLKRGHDRGKKHSIIIVAEGVGSGVEFGKRIEEETNL
ETRVSVLGHIQRGGSPSASDRVLASRLGAYAVELLLEGKGGRCVGIQNNKLVDHDIIEIL
ETKHTVEPNMYQLSKELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgtataggagtattaacgagcggcggggattccccggggatgaacgcagcggtg
cgcgcggttgtgcggaaagctatctaccacgatgtagaagtatacggaatttataacggt
tattcaggattaatcagcggaaaaatagagaaactggagctgggttcggtcggcgacatc
atccatcgcggaggaacaaagctgtacacggccagatgtcctgaattcaaaacagttgaa
ggccgtgaaaaaggaatcgaaaatttaaagaaactcggcatcgaaggtcttgtcgttatc
ggcggagacggttcatacatgggtgcgaaaaaattaacggaacacgggtttccatgtgta
ggtgtaccgggtacgatagataatgacatcccgggaactgattttacgatcggatttgat
acggcgttaaacaccgtaattgatgcgattgataaaatccgtgacaccgctacgtcgcat
gagcgtacatacgttattgaagttatggggcgccatgcaggcgacattgctttatgggca
gggcttgcaggcggagcggaatcaattttaattcctgaagcggattacgatatggaggaa
attatcggccgtttgaagagagggcatgaccgcggcaaaaaacacagtatcatcatcgtt
gcagaaggggtaggcagcggggttgaattcggaaaacgcatcgaagaagagacgaacctt
gaaacacgggtatccgttttagggcacatccagcgcggcggatctccaagcgcttctgac
cgggttcttgcaagccgcctcggcgcttacgcggttgagcttctgcttgaaggaaaaggc
ggacgctgcgtaggtatacaaaacaacaagcttgtagaccatgatattatagaaatttta
gagacaaaacatactgttgaaccaaacatgtatcagctttcaaaagaactgtctatttaa

DBGET integrated database retrieval system