KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_2797Help
Entry
BAMF_2797         CDS       T01321                                 

Gene name
ytjP
Definition
(GenBank) putative dipeptidase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
bao  Bacillus amyloliquefaciens DSM 7
Pathway
bao00300  Lysine biosynthesis
bao01100  Metabolic pathways
bao01120  Microbial metabolism in diverse environments
bao01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bao00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    BAMF_2797 (ytjP)
Enzymes [BR:bao01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     BAMF_2797 (ytjP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 Peptidase_M28 M20_dimer
Motif
Other DBs
NCBI-ProteinID: CBI43923
Position
complement(2847186..2848580)
Genome map
AA seq 464 aa AA seqDB search
MNWEVEVIRNKEDLIRDTQKFLQINSVMDESTAGPGRPFGEGVGDCLTSLLEFGEKEGFT
VKNLDGYAGHIEWGTGDEIVGVLCHVDVVPPGDGWTSDPFSADIRDGRIYARGAIDDKGP
TMAAFYALKIVKDMQLPLSKRVRIIIGTDEESDWRCVDHYFKHEKMPDVGFAPDADFPII
NAEKGIIDASLRIAKSASDKEDAKNGLLSFRSGLRLNMVPDAAEAVIEGDGLDAVHAYFS
NWLEQSKTQGEAVSENGKLTLRVYGKSCHAMEPDNGINAGLKLAECLERAELDEAGKHFV
KTVSDYFSNDTRGKKLKIDCRDDISGELTLNVGTFTYNKGEEGELGINIRYPVTSDSKVI
RDAFMSVEEFRLEEFKDSKPHHVSADHPLVKTLQNVYEGQTGKKADLISIGGGTYARSLS
AGVAFGPLFPDRPDSAHQKDEYIEIDDLLRSTALYAQAIYELAK
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgaactgggaagttgaagtgatcagaaacaaagaagatctgattcgtgacacgcagaag
tttctgcaaatcaacagcgtaatggacgaatcaacagccggtcccggccggccgtttgga
gaaggcgtaggtgactgcctgacttcactgttggaattcggtgaaaaagaaggcttcacc
gtaaaaaatcttgacggctatgcgggccatattgagtgggggacgggtgacgaaatcgtc
ggtgttctgtgccacgtcgacgtcgttccgcccggagacggctggacgagcgatccgttt
tcagccgacatcagggatggccggatatatgccagaggtgccattgatgataaagggccg
acaatggcggcgttttacgcgctgaaaatcgtcaaagacatgcagctgcctttatccaaa
cgcgtgagaatcatcatcggaacggatgaagagagtgattggagatgtgtggaccactac
ttcaaacacgaaaaaatgcctgatgtcggatttgcccctgacgcagattttccgatcatt
aacgcagaaaaaggaattatagacgcatcactgcgcattgcaaaaagcgcttctgataaa
gaagacgcaaaaaacgggcttctgtcattccgttcaggactgcgcttgaacatggtgccg
gatgcggctgaagcggtcattgaaggggacggtcttgatgccgtacacgcctatttcagc
aactggctggagcaatcaaaaacacaaggtgaagcggtttcagaaaatggaaaactgacg
cttcgggtgtacgggaaatcatgccacgcaatggagccggataatggcataaatgccggc
ttaaagcttgctgaatgccttgagcgagcggaactggatgaggccggaaagcactttgtc
aaaactgtcagtgactatttttctaatgatacacgaggcaaaaagctgaaaattgattgc
agggatgacatcagcggagagcttacattgaatgtcggcacctttacatacaataagggt
gaggaaggggaactcggcatcaacattcgttaccctgtcacttcagacagcaaagtcatc
cgtgatgcctttatgtctgttgaagaattccggcttgaagaatttaaagacagcaaaccg
caccacgtatctgccgaccatccgctcgtaaagacgcttcagaacgtatacgaagggcag
acgggaaagaaagcggatctgatttcaatcggcggaggaacgtatgcgagatccctttcg
gctggcgtcgcattcgggccgctgtttcccgacaggcctgacagcgcgcatcaaaaggat
gagtacattgagattgatgaccttctccggtcaaccgccttatacgctcaagccatttat
gagcttgccaagtga

DBGET integrated database retrieval system