KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_2811Help
Entry
BAMF_2811         CDS       T01321                                 

Gene name
melA
Definition
alpha-D-galactoside galactohydrolase (EC:3.2.1.-)
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
bao  Bacillus amyloliquefaciens DSM 7
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bao00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:bao00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:bao00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2862625..2863923
Genome map
AA seq 432 aa AA seqDB search
MKKITFIGAGSTIFAKNVLGDCLLTEALNGFEFALYDIDAVRLKESQLMLENMRDRYNTS
VSIISYDDRKQALKQAGYVINAIQVGGYKPATVIDFDIPKRYGLRQTIADTVGIGGIFRS
LRTIPVLFDIAKDMEEVCPDAWLLNYTNPMASLTGAMLRHTNVKTVGLCHSVQVCTKDLF
DSLGMDHEGTEERIAGINHMAWLLEIKKDGIDLYPEIKRRAREKQKTKHNDMVRFELMDK
FGCYVTESSEHNAEYHPYFIKSRYPELIDELQIPLDEYPRRCAEQIKNWETIRDGIINNQ
NLTHERSNEYGSRIIEAMETGRPFMFGGNVLNTGLIPNLPAKAVVEVPCAAVKNQIMPCY
SGELPEQLAALNRTNINTQLLTIEAAVTLKKEAVYQAAMLDPHTSAELSMNDIISLCDDL
FEAHKDWLPAYH
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
ttgaagaaaattacgtttatcggagcgggaagcacgatatttgcgaaaaatgtactggga
gactgtttactgactgaagctttaaacggatttgaattcgcgctttatgatattgatgct
gtacggctgaaagaatcccagctcatgctggaaaacatgagagaccgctataatacgagc
gtatccatcatttcttacgatgaccgaaaacaggcgctaaaacaggccggctatgtgata
aacgccattcaggtcggcggttataaacccgcgacggtcattgactttgacatccctaag
cggtacggcctgcgccagacgattgccgataccgtcggaataggcggcattttccgttcc
cttcgcaccatccccgttttatttgacatcgctaaagacatggaagaggtctgtccggat
gcgtggctgttaaactatacaaatccgatggcttctctgaccggcgcgatgctcagacat
acaaatgtaaaaacggtcggcctgtgccacagcgtacaggtctgtacaaaagatctgttt
gactcactcggcatggatcacgaaggtacggaagaacgcattgccggcatcaatcacatg
gcttggctcttagagatcaaaaaagacggaattgatttgtatccggaaattaaaagacgc
gcccgcgagaaacaaaagacgaaacataatgacatggtgcggtttgagctgatggataag
ttcggctgctacgtaacggaatcatctgagcacaatgccgaatatcacccgtattttata
aaaagccggtatccggagctgatagatgaactccagatcccgctagatgaatatccgaga
agatgcgcagaacaaatcaaaaactgggaaacgataagagacggcatcatcaacaatcaa
aacctgacgcatgagcgctcgaatgaatacggttcgagaattatagaagcgatggagacg
ggccgtccgtttatgttcggcggcaatgtgctgaatacgggactcataccgaatctgccg
gcgaaagcagtcgttgaagtgccttgcgcagccgttaaaaatcaaattatgccttgctat
tcaggcgaacttccggaacagctcgcggcgcttaacagaacaaacattaatacacagctt
ttaaccatcgaagcggccgttactttaaaaaaggaagccgtatatcaggcggccatgctt
gatccgcatacgagcgccgagctttccatgaatgacatcatctctttgtgcgatgattta
tttgaagcccataaagactggcttccggcgtatcactga

DBGET integrated database retrieval system