KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_2811Help
Entry
BAMF_2811         CDS       T01321                                 

Gene name
melA
Definition
alpha-D-galactoside galactohydrolase (EC:3.2.1.-)
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
bao  Bacillus amyloliquefaciens DSM 7
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:bao00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BAMF_2811 (melA)
  Lipid metabolism
   00561 Glycerolipid metabolism
    BAMF_2811 (melA)
   00600 Sphingolipid metabolism
    BAMF_2811 (melA)
Enzymes [BR:bao01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     BAMF_2811 (melA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2862625..2863923
Genome map
AA seq 432 aa AA seqDB search
MKKITFIGAGSTIFAKNVLGDCLLTEALNGFEFALYDIDAVRLKESQLMLENMRDRYNTS
VSIISYDDRKQALKQAGYVINAIQVGGYKPATVIDFDIPKRYGLRQTIADTVGIGGIFRS
LRTIPVLFDIAKDMEEVCPDAWLLNYTNPMASLTGAMLRHTNVKTVGLCHSVQVCTKDLF
DSLGMDHEGTEERIAGINHMAWLLEIKKDGIDLYPEIKRRAREKQKTKHNDMVRFELMDK
FGCYVTESSEHNAEYHPYFIKSRYPELIDELQIPLDEYPRRCAEQIKNWETIRDGIINNQ
NLTHERSNEYGSRIIEAMETGRPFMFGGNVLNTGLIPNLPAKAVVEVPCAAVKNQIMPCY
SGELPEQLAALNRTNINTQLLTIEAAVTLKKEAVYQAAMLDPHTSAELSMNDIISLCDDL
FEAHKDWLPAYH
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
ttgaagaaaattacgtttatcggagcgggaagcacgatatttgcgaaaaatgtactggga
gactgtttactgactgaagctttaaacggatttgaattcgcgctttatgatattgatgct
gtacggctgaaagaatcccagctcatgctggaaaacatgagagaccgctataatacgagc
gtatccatcatttcttacgatgaccgaaaacaggcgctaaaacaggccggctatgtgata
aacgccattcaggtcggcggttataaacccgcgacggtcattgactttgacatccctaag
cggtacggcctgcgccagacgattgccgataccgtcggaataggcggcattttccgttcc
cttcgcaccatccccgttttatttgacatcgctaaagacatggaagaggtctgtccggat
gcgtggctgttaaactatacaaatccgatggcttctctgaccggcgcgatgctcagacat
acaaatgtaaaaacggtcggcctgtgccacagcgtacaggtctgtacaaaagatctgttt
gactcactcggcatggatcacgaaggtacggaagaacgcattgccggcatcaatcacatg
gcttggctcttagagatcaaaaaagacggaattgatttgtatccggaaattaaaagacgc
gcccgcgagaaacaaaagacgaaacataatgacatggtgcggtttgagctgatggataag
ttcggctgctacgtaacggaatcatctgagcacaatgccgaatatcacccgtattttata
aaaagccggtatccggagctgatagatgaactccagatcccgctagatgaatatccgaga
agatgcgcagaacaaatcaaaaactgggaaacgataagagacggcatcatcaacaatcaa
aacctgacgcatgagcgctcgaatgaatacggttcgagaattatagaagcgatggagacg
ggccgtccgtttatgttcggcggcaatgtgctgaatacgggactcataccgaatctgccg
gcgaaagcagtcgttgaagtgccttgcgcagccgttaaaaatcaaattatgccttgctat
tcaggcgaacttccggaacagctcgcggcgcttaacagaacaaacattaatacacagctt
ttaaccatcgaagcggccgttactttaaaaaaggaagccgtatatcaggcggccatgctt
gatccgcatacgagcgccgagctttccatgaatgacatcatctctttgtgcgatgattta
tttgaagcccataaagactggcttccggcgtatcactga

DBGET integrated database retrieval system