KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_3190Help
Entry
BAMF_3190         CDS       T01321                                 

Gene name
cysI
Definition
sulfite reductase (NADPH) hemoprotein beta-component (EC:1.8.1.2)
Orthology
K00381  
sulfite reductase (NADPH) hemoprotein beta-component [EC:1.8.1.2]
Organism
bao  Bacillus amyloliquefaciens DSM 7
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Module
Assimilatory sulfate reduction, sulfate => H2S
Brite
KEGG Orthology (KO) [BR:bao00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    BAMF_3190 (cysI)
Enzymes [BR:bao01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.2  sulfite reductase (NADPH)
     BAMF_3190 (cysI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3245136..3246851)
Genome map
AA seq 571 aa AA seqDB search
MVNNILKAPEGPPSDVEEIKEKSDYLRGTLKEVMLDRISAGIPDDDNRLMKHHGSYLQDD
RDLRNERQKQKLEPAYQFMLRVRMPGGVSTPEQWLVMDELAQKYGNNTLKLTTRETFQMH
GILKWNMKKTIQKINEALLDTIAACGDVNRNVMCASNPYQSEIHAEVYEWSKKLSDDLLP
RTRAYHEIWLDEERVAGTPDTETEPMYGPLYLPRKFKIGIAVPPSNDIDVFSQDLGFIAI
VEEGRLIGFNVAIGGGMGMTHGDTATYPQLSKVIGFCKPEQLYDVAEKTITIQRDYGNRS
VRKNARFKYTVDRLGLENVKAELENRLGWQLDEAKPYHFDHNGDRYGWVKGVKGTWHFTM
FIEGGRVTDYEDYKLMTGLREIAKVHTGDFRLTSNQNLIIGNVTSEKKKQISALIEQYGL
TDGRQHSALRRSSMACVALPTCGLAMAEAERYLPKLIDKIEAIVDENGLRDEEITIRMTG
CPNGCARHALGEIGFIGKAPGKYNMYLGAAFDGSRLSKMYRENIGEEEILSELRTILPRY
AKEREEGEHFGDFVIRAGIIKATTDGTNFHE
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atggtgaacaacattttaaaagcgccggaaggccctccaagtgatgttgaggaaattaaa
gaaaaaagtgattatttgcgcggcacattgaaagaagtcatgcttgaccggatttcagcc
ggcatcccggacgatgacaaccggctgatgaagcatcacggcagctacctgcaggatgac
cgcgatctccgcaatgaacgtcagaaacaaaagcttgaaccggcttatcaattcatgctg
cgcgtccggatgccaggcggcgtgtcaactccggagcaatggcttgtcatggatgaactg
gcgcaaaaatacggaaacaatacattaaagctgacaacgcgcgaaacgttccaaatgcac
ggaattttaaaatggaacatgaaaaaaacgattcagaaaatcaatgaggcgctgcttgat
accattgcggcctgcggagatgtcaaccgaaacgtcatgtgcgcttcaaatccgtatcag
tctgaaatccatgcggaagtgtacgaatggtcgaaaaaactgagtgatgaccttcttccg
cgcacgagagcctatcatgaaatctggcttgatgaggaacgtgtggcgggcactcctgat
acggaaacggaaccgatgtacgggccgctgtatttgccgcggaaattcaaaatcggaatc
gccgtgcctccgtccaatgatatcgatgtcttttctcaagatctcggcttcattgcgatt
gtagaagaaggcagacttatcggattcaacgtggcgatcggcggcggtatgggaatgacg
cacggtgatacggccacttatccgcagctttcaaaagtcatcggcttctgcaaaccggag
cagctgtatgatgtagcggaaaaaaccattacgattcagcgtgattacggaaatcgttcc
gtcagaaagaatgccagatttaaatatactgttgaccgtctcggtctggaaaatgtaaaa
gccgagctggaaaaccgcctcggctggcagctggatgaggcgaaaccttatcattttgac
cataacggcgaccgttacggatgggtgaaaggcgtaaaaggaacatggcattttacgatg
ttcatcgaaggcggccgtgtcacggactatgaggattataagctgatgacgggattacgt
gaaatcgccaaagtccatacgggagatttccgtctcacctctaatcaaaacctgattatc
ggcaatgtgacgagcgagaaaaagaaacaaatcagcgcattaatcgaacaatacggtctg
acagacggccggcagcattccgccctgcgccgcagttcaatggcttgcgtcgcgcttccg
acatgcgggctcgcgatggccgaagcggagcggtatctgccaaagctgattgataaaatt
gaagccattgttgacgaaaacggtctgcgggatgaagagatcaccatccgtatgactggc
tgcccgaatggctgcgcccgccatgcgctcggtgaaatcggatttatcggaaaagcgccg
ggaaaatataatatgtatttaggagctgcatttgacggcagccgtttaagcaaaatgtac
cgggaaaatatcggtgaagaggagattctcagtgagctccgcaccattctgccgcgttat
gcgaaagagcgcgaggaaggcgaacactttggagatttcgtcatccgtgcgggcattatt
aaagcgacaacagacggaacgaattttcacgaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system