KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_3254Help
Entry
BAMF_3254         CDS       T01321                                 

Gene name
tpiA
Definition
(GenBank) triose phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bao  Bacillus amyloliquefaciens DSM 7
Pathway
bao00010  Glycolysis / Gluconeogenesis
bao00051  Fructose and mannose metabolism
bao00562  Inositol phosphate metabolism
bao01100  Metabolic pathways
bao01110  Biosynthesis of secondary metabolites
bao01120  Microbial metabolism in diverse environments
bao01130  Biosynthesis of antibiotics
bao01200  Carbon metabolism
bao01230  Biosynthesis of amino acids
Module
bao_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bao_M00002  Glycolysis, core module involving three-carbon compounds
bao_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bao00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAMF_3254 (tpiA)
   00051 Fructose and mannose metabolism
    BAMF_3254 (tpiA)
   00562 Inositol phosphate metabolism
    BAMF_3254 (tpiA)
Enzymes [BR:bao01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BAMF_3254 (tpiA)
Exosome [BR:bao04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BAMF_3254 (tpiA)
  Exosomal proteins of bladder cancer cells
   BAMF_3254 (tpiA)
  Exosomal proteins of melanoma cells
   BAMF_3254 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: CBI44380
Position
complement(3308286..3309047)
Genome map
AA seq 253 aa AA seqDB search
MRKPIIAGNWKMNKTLGEAVSFVEEVKNSIPAADKAEAVVCAPALFLEKLTSAVKGTDLK
VGAQNMHFEENGAFTGEISPVALKDLGVDYCVIGHSERREMFAETDETVNKKAHAAFKHG
IVPIICVGETLEEREAGKTNDLVADQVKKGLAGLSEEQVAASVIAYEPIWAIGTGKSSTA
KDANDVCAHIRKVVAESFSQEAADKLRIQYGGSVKPANIKEYMAESDIDGALVGGASLEP
QSFVQLLEEGQYE
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaccaattatagccggtaactggaaaatgaacaaaactctcggcgaggctgtc
agcttcgttgaagaagtgaaaaattccattccagcagcagacaaagcggaagccgttgtt
tgcgcaccagctcttttcttagaaaagctgacttctgctgttaaaggaactgacttaaaa
gtcggcgcccaaaacatgcattttgaagaaaacggtgcgttcacaggcgaaatcagcccg
gtcgctctgaaagaccttggcgtggattactgcgtcatcggccactctgagcgccgtgaa
atgttcgctgaaactgatgaaacagttaacaaaaaagcgcatgccgctttcaaacacggc
attgtgccgatcatttgcgtaggtgaaacgcttgaagagcgcgaagccggaaaaacaaat
gatcttgttgccgatcaagtgaaaaaaggtcttgcgggtctttctgaagagcaagttgca
gcttccgttattgcgtacgagccaatctgggcaatcggaacaggcaaatcttctacagcg
aaagatgcaaacgacgtctgcgcgcatatccgcaaagttgttgctgaaagcttcagccaa
gaagctgctgacaagctccgcattcaatacggcggcagcgtaaaacctgcaaatattaaa
gaatatatggcagagtccgatattgacggtgctttggtcggcggcgcaagccttgaaccg
cagtcattcgttcaattattggaggaaggtcaatatgagtaa

DBGET integrated database retrieval system