KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_3574Help
Entry
BAMF_3574         CDS       T01321                                 

Gene name
speB
Definition
(GenBank) agmatinase
  KO
K01480  agmatinase [EC:3.5.3.11]
Organism
bao  Bacillus amyloliquefaciens DSM 7
Pathway
bao00330  Arginine and proline metabolism
bao01100  Metabolic pathways
Module
bao_M00133  Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:bao00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BAMF_3574 (speB)
Enzymes [BR:bao01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     BAMF_3574 (speB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase UPF0489
Motif
Other DBs
NCBI-ProteinID: CBI44700
Position
complement(3629930..3630802)
Genome map
AA seq 290 aa AA seqDB search
MRFDEAYSGKVFIASRPDWKEADAILYGMPMDWTVSYRPGSRFGPGRIREVSIGLEEYSP
YLDSDLADLNFFDAGDIPLPFGNPQRSLDMIEEYVDSILEKGKFPLGMGGEHLVSWPVIK
AMYKKFPDLAIIHFDAHTDLRTDYEGEPLSHSTPIRKAAELIGPQNVFSFGIRSGMKEEF
EWAKENGMHISKFEVLEPLKKVLPQLAGRPVYVTIDIDVLDPAHAPGTGTVDAGGITSKE
LLASIHEIARSEVSVKGADLVEVAPIYDHSEQTANTASKMIREMLLGFVK
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgaggtttgatgaagcatattcaggaaaagtatttatcgcaagccgccccgattggaaa
gaggcggacgccatcctctacggcatgccgatggattggacggtcagctaccgcccgggt
tcacggttcggcccggggagaatccgcgaggtgtctatcggtcttgaagaatacagcccg
tatctcgacagtgacttggctgatttgaatttctttgacgccggcgacattccgcttccg
ttcggcaatccgcaaagaagccttgatatgattgaggaatacgtggacagcattttagaa
aaaggaaagttcccgctcggcatgggaggggagcaccttgtgtcatggcctgtcattaaa
gccatgtataagaagtttccggaccttgccatcattcattttgacgcgcacacagacctg
cgcacggattatgaaggcgagccgctttcccactctacaccgatccgcaaagcggccgag
cttatcgggccgcaaaacgtattttcattcggcatccgttccggaatgaaggaagaattt
gaatgggcgaaagaaaacggcatgcacatttctaagtttgaagtgcttgagccgctgaaa
aaagtgctgccgcagctcgcgggacgtcctgtttatgtcaccatcgatatcgacgttctt
gaccccgctcatgcgccgggaacgggcacggttgacgcaggaggcatcacgtctaaggaa
ttgctcgcgtccatccatgaaatcgcccgctcagaagtcagcgtaaaaggagctgacctt
gtagaagtcgcgccgatctatgaccactccgaacaaaccgcaaacacggcaagcaagatg
attcgtgaaatgctgcttgggtttgtgaagtag

DBGET integrated database retrieval system