KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_3616Help
Entry
BAMF_3616         CDS       T01321                                 

Gene name
spsL
Definition
(GenBank) spore coat polysaccharide synthesis protein SpsL
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
bao  Bacillus amyloliquefaciens DSM 7
Pathway
bao00521  Streptomycin biosynthesis
bao00523  Polyketide sugar unit biosynthesis
bao01130  Biosynthesis of antibiotics
Module
bao_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:bao00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    BAMF_3616 (spsL)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BAMF_3616 (spsL)
Enzymes [BR:bao01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     BAMF_3616 (spsL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom Cupin_2
Motif
Other DBs
NCBI-ProteinID: CBI44742
Position
complement(3670019..3670480)
Genome map
AA seq 153 aa AA seqDB search
MQVIEGVKIKKLIKHSDDRGFFSELVRDDEQLLEHFGQASWSKSYPGVIKAFHYHEKQDD
LWFFPTGHAQVVLHDLREESATKGETDVYYMGEDNPMLLLIPKGVAHGYRVLGETPLTII
YFTTMSYNPDQPDEKRIPWNDETIGFDWKTAHR
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
gtgcaagtgatcgaaggcgtaaaaatcaaaaagctgatcaaacacagtgacgaccgaggt
tttttctcagaactcgtccgtgacgatgaacaacttctggaacatttcgggcaggcttcc
tggtcaaaaagctatcccggcgtcattaaagcgtttcactatcatgagaaacaggatgac
ctgtggtttttcccgacgggccatgcccaagtcgtgctgcatgaccttcgcgaagagtca
gcaaccaagggagaaacggatgtctactacatgggagaagacaatccgatgctgcttctc
attcccaaaggagtcgcgcacggttacagagtgctgggagaaaccccgctgactattatt
tattttacgacaatgtcctataatccggatcagcctgacgaaaaaagaatcccgtggaat
gatgaaaccatcggatttgactggaagacggctcatcggtag

DBGET integrated database retrieval system