KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_3825Help
Entry
BAMF_3825         CDS       T01321                                 

Gene name
fbp
Definition
(GenBank) fructose-1,6-bisphosphatase
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
bao  Bacillus amyloliquefaciens DSM 7
Pathway
bao00010  Glycolysis / Gluconeogenesis
bao00030  Pentose phosphate pathway
bao00051  Fructose and mannose metabolism
bao00680  Methane metabolism
bao01100  Metabolic pathways
bao01110  Biosynthesis of secondary metabolites
bao01120  Microbial metabolism in diverse environments
bao01130  Biosynthesis of antibiotics
bao01200  Carbon metabolism
Module
bao_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bao00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAMF_3825 (fbp)
   00030 Pentose phosphate pathway
    BAMF_3825 (fbp)
   00051 Fructose and mannose metabolism
    BAMF_3825 (fbp)
  Energy metabolism
   00680 Methane metabolism
    BAMF_3825 (fbp)
Enzymes [BR:bao01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     BAMF_3825 (fbp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2
Motif
Other DBs
NCBI-ProteinID: CBI44951
Position
3884025..3885950
Genome map
AA seq 641 aa AA seqDB search
METKYLDLLAQKYDCEEKVVTEIINLKAILNLPKGTEHFVSDLHGEYQAFQHVLRNGSGR
VKEKIRDIFSGVIYDREIDELAALVYYPEDKLKLIKHDFDTKEALNDWYEETIHRMIKLV
SYCSSKYTRSKLRKALPAQFAYISEELLYKTEQAANKEQYYSEIIEQIIALGQADKLITG
LAYSTQRLVVDHLHVVGDIYDRGPQPDKIMEELINYHSVDIQWGNHDVLWIGAYSGSKVC
LANIIRICARYDNLDIIEDVYGINLRPLLNLAEKYYDDNPSFRPKADENRPEDEIKQITK
IHQAIAMIQFKLESPIIKRRPNFNMEERLLLEKIDYDRNEITLNGKTYQLENTCFATVNP
KQPDELLEEEAEVMDKLLFSVQHSEKLGRHMNFMMKKGSLYLKYNGNLLIHGCIPVDENG
SMETMMIEDKAYAGRELLDVFERFLRNAFAHPEETDDLATDMVWYLWTGEYSSLFGKRAM
TTFERYFIKEKETHKEKKNPYYYLREDEATCRNILKEFGLNPDHGHIINGHTPVKEIEGE
DPIKANGKMIVIDGGFSKAYQSTTGIAGYTLLYNSYGMQLVAHKHFNSKAEVLSTGTDVL
TVKRLVDKELERKKVKETNVGEELLKEVAILEKLREYRYMK
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
ttggaaacgaaatatttagatctgctcgcacaaaaatacgattgtgaagaaaaagtggtc
acagaaatcataaatctgaaagcaatactgaacctgccgaaaggaaccgagcatttcgtc
agtgatttgcacggggagtatcaggcattccagcacgtgctgcggaatggttcaggaaga
gtaaaagagaagatccgcgatattttcagcggtgtcatttacgatagagaaattgatgaa
ctggcagcattggtctattatccggaagacaaactcaaattaatcaaacatgactttgat
acaaaagaagcattaaacgattggtatgaagaaacgattcatcgaatgattaagctcgtt
tcttattgctcttccaaatacacccgctccaaattgcgcaaggcgctgcctgcccaattt
gcttatatttctgaagagctgctgtacaaaacagaacaagccgccaacaaggaacaatat
tattccgaaatcatagaacaaatcattgcgctcggccaagccgataagctgatcaccggt
cttgcatacagcacgcagcgattggtggtcgaccatctgcatgttgtcggcgatatttac
gaccgcggaccccagcctgataaaattatggaagaactgatcaactatcattcagtggat
attcaatgggggaatcatgatgttctctggataggcgcctattccggctcgaaggtatgc
ctggccaatattatccgcatctgtgcccgctatgacaacctggatattattgaagacgtc
tacggcatcaacctgagaccgctcttgaacctggccgaaaaatattatgatgataacccg
tctttccgcccgaaagcggatgaaaacagaccagaagatgaaattaagcaaatcacaaaa
attcatcaggcgatcgcgatgatccaattcaagcttgagagcccgattatcaagagacgg
ccgaactttaacatggaggaacggctgttactggaaaagattgattatgatcgaaatgaa
atcacgctgaacggaaaaacatatcaactggaaaacacctgctttgcgacggttaatcca
aagcagccggatgagctattagaggaagaagcggaagtcatggacaagctgctgttctct
gttcagcattccgaaaagctgggccgccatatgaactttatgatgaaaaaaggcagcctt
tacttaaaatacaacggcaacctattgattcacggctgtattcctgtcgacgaaaacggc
agcatggaaacgatgatgattgaggataaagcctatgcgggccgtgagctgctcgatgta
tttgaacggttcttacggaatgccttcgcccacccggaagaaaccgatgatctggcgaca
gacatggtctggtatttatggacaggcgagtattcctccctcttcggaaaacgcgccatg
acgacctttgagcggtatttcattaaagagaaagaaacgcataaagaaaagaaaaacccg
tattactatttgcgcgaagacgaggcaacctgccgaaacatcctgaaagagttcggtctc
aacccggatcacggccatatcatcaacggccatacaccggtaaaagaaatcgaaggcgaa
gatccgatcaaagcaaacggaaaaatgatcgtcatcgacggaggcttctctaaagcctac
caatccacaacaggcatcgccggctacacgctcttatacaactcttacggcatgcagctc
gtcgcccataaacactttaactcaaaggccgaagtgctgagcaccggaaccgacgtctta
acagtgaaacgcttagtcgacaaagagctggagcggaagaaagtaaaagaaacgaatgtt
ggcgaggaactgctgaaggaagtggctattttggagaaactgcgggagtatcggtatatg
aagtga

DBGET integrated database retrieval system