KEGG   Buchnera aphidicola 5A (Acyrthosiphon pisum): BUAP5A_141Help
Entry
BUAP5A_141        CDS       T00820                                 

Gene name
folA
Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
bap  Buchnera aphidicola 5A (Acyrthosiphon pisum)
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bap00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BUAP5A_141 (folA)
   00670 One carbon pool by folate
    BUAP5A_141 (folA)
Enzymes [BR:bap01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     BUAP5A_141 (folA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(149143..149628)
Genome map
AA seq 161 aa AA seqDB search
MNISLIAAISKNLVIGYKNKIPWYLPEDLKWFKQKTINKNIIMGRLTWESIKKKPLPMRK
NIVISSNEIKQEGIIWADSISNAIISAQYNQEIMIIGGAKIYKEMLFYANKLYLTHIDID
IVGDAYFPEYKLYPYWKTLFRKKNTKNKMNPYNYSFEILSR
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgaatataagtttaattgctgctatatctaaaaatttagttatcggatataaaaataaa
ataccttggtatcttccagaagatttaaaatggtttaaacaaaaaacgattaataaaaac
ataattatgggtcgattaacttgggagtctattaaaaaaaaacccttaccaatgcgtaaa
aacatagttattagtagcaatgaaatcaaacaagagggtattatttgggctgattcaata
tctaatgcaattatatctgcacaatacaatcaagaaattatgattattggtggtgctaaa
atatataaagaaatgctattttatgctaataaattatatttaactcatatagatattgat
attgttggtgatgcttattttcctgaatataagttatatccatattggaaaacattattt
agaaaaaaaaataccaaaaataaaatgaatccatacaattattcatttgaaattttatca
agataa

DBGET integrated database retrieval system