KEGG   Buchnera aphidicola 5A (Acyrthosiphon pisum): BUAP5A_167Help
Entry
BUAP5A_167        CDS       T00820                                 

Gene name
ychB
Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
bap  Buchnera aphidicola 5A (Acyrthosiphon pisum)
Pathway
bap00900  Terpenoid backbone biosynthesis
bap01100  Metabolic pathways
bap01110  Biosynthesis of secondary metabolites
bap01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bap00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BUAP5A_167 (ychB)
Enzymes [BR:bap01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     BUAP5A_167 (ychB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ACL30542
Position
complement(183463..184347)
Genome map
AA seq 294 aa AA seqDB search
MNKRNQKKMIYTCLSPAKINLFLYVTGRRKDGYHNIQTLFQFLDYGDQFKIIANKTGNIE
LFTEKKIFMNVQNSIIIAAKLLKKTALLQGKLQNSSYGAKIFLKKNIPMGSGLGGGSSNA
ATTLVVLNKLWNTQYTLKELSLLGLRIGADVPGFVMGNTAVIEGIGDILYPIVQKEKWYL
VVYPCINISTRYMFSSPFLMSNTAKKSLQVLLKTPFKNDFENIAKKQFVPIKKLIRMLSS
YAPSRMTGTGSCVFSEFDNKKSAQKIFSVLPKNVQGFIAKSVNISPLHKTLYKR
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaacgaaaccaaaaaaaaatgatttatacatgtttgtctcccgcaaaaattaat
ctttttctatatgtcacaggtagacgaaaagatggatatcataatatacaaacattgttt
caatttcttgattatggtgatcaattcaaaataattgctaataaaacaggtaatattgaa
ttattcactgaaaaaaaaatttttatgaatgtacaaaatagtattattattgctgctaaa
ctattaaaaaaaactgcactcttacaaggtaaattacaaaattctagttatggagcaaaa
atatttttaaaaaaaaacatacctatgggtagtggattaggaggaggttcttcaaacgct
gcaaccactttagttgttctaaacaaattatggaatacacaatatacattgaaagaacta
tctttattaggactcagaataggggctgacgtacctggttttgttatgggcaatacagct
gttattgaaggaataggagatatattatatcctattgtgcaaaaagaaaaatggtattta
gttgtctatccttgtattaatatttcaacacgttatatgttttcaagtccatttttaatg
agtaatacagctaaaaaatcactccaagtattattaaaaacaccttttaaaaatgacttc
gaaaatatagcaaaaaaacaatttgtcccaataaaaaaattaattagaatgttatcttca
tatgcgccttcacgcatgactggcacaggatcttgtgttttttctgaatttgataataaa
aaatctgcacaaaaaattttttccgtgttacctaaaaacgtccaagggtttatagcaaaa
agtgttaatatttcaccattgcataaaactctttataaacgataa

DBGET integrated database retrieval system