KEGG   Buchnera aphidicola 5A (Acyrthosiphon pisum): BUAP5A_189Help
Entry
BUAP5A_189        CDS       T00820                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
bap  Buchnera aphidicola 5A (Acyrthosiphon pisum)
Pathway
bap00260  Glycine, serine and threonine metabolism
bap00750  Vitamin B6 metabolism
bap01100  Metabolic pathways
bap01110  Biosynthesis of secondary metabolites
bap01120  Microbial metabolism in diverse environments
bap01230  Biosynthesis of amino acids
Module
bap_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bap00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BUAP5A_189 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BUAP5A_189 (thrC)
Enzymes [BR:bap01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BUAP5A_189 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N SAGA-Tad1 PRMT5_C
Motif
Other DBs
NCBI-ProteinID: ACL30562
Position
complement(207014..208303)
Genome map
AA seq 429 aa AA seqDB search
MKLYNLKNHNEQVNFEAAVKLGLGQQQGLFFPVELPTITPIELSKILKMDFITRSTEILS
KFICHEISKEELYKHVKQAFSFKHPLKIKITKDIHCFELFHGPTLAFKDFGARFMAQMIL
LLNKKNESVTILTATSGDTGAAVANAFYGMKNVRVIILYPKGKISELQEKLFCTLGRNIK
TISINGSFDDCQKLVKEAFNDKKLKESIGLNSANSINISRLLAQICYYFEAFSLISEEQR
KNLVIAVPCGNFGNLTAGLLSKSLGLPIKSFIACTNANDTVPRFLNNGTWNPKKTVSTIS
NAMDISQPNNWTRIEELFYRKKWDLKKLRFGSVSDHTTEETLKELFKLGYVSEPHAAIAY
RLLRDQLKENEFGLFLGTAHPAKFKNTVEKILKNKISLPSELQNRIDLPLLSHNINPVFS
KLKTFLLEK
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaaactttacaatttaaaaaaccataacgaacaagtaaattttgaagcagccgtaaaa
ttaggattaggtcagcaacaagggttgtttttccctgtagaattacctactattactcct
attgaattatcaaaaatattaaaaatggattttattactcgcagtactgaaatactttct
aaattcatttgtcatgaaatatctaaagaagaactatataaacatgttaaacaagcattt
tcatttaaacatccattaaaaataaaaattacaaaagatatacattgcttcgaactgttt
cacggtccaacattggcgtttaaagattttggagctcgttttatggctcaaatgatatta
ttactaaataaaaaaaatgaatcagttactattttaactgcaacatcaggtgatacaggt
gcagcggtagcaaatgcattctatggaatgaaaaatgtgcgagtaattattttatatcct
aaaggcaagatcagtgaattacaagagaaattattttgtactttaggtagaaatataaaa
actatatcaattaatggtagttttgacgattgtcaaaaattagtaaaagaagcttttaac
gataaaaaactgaaagaatcaataggattaaattcagctaattcaattaatataagtaga
ttattagcacaaatctgttattattttgaagctttctctttaatttcagaagaacaaaga
aaaaatttagtaatagcagttccatgcggtaattttggaaatttaacagctggattatta
tctaaatctcttggtttgccaatcaaatcatttatagcatgtacgaatgcgaatgatacc
gtaccaagattccttaataatggcacgtggaatcctaaaaaaactgtatctacaatttct
aatgctatggatatcagtcaacctaataattggactcgaattgaagaattattttatcga
aaaaaatgggatttaaaaaaacttaggtttggaagtgtatcggatcatactacagaagaa
acattaaaagaactatttaaattaggttatgtttctgaacctcatgcagcaatagcatat
agattgttgcgagatcaattaaaagaaaatgaatttggcttatttttaggcaccgctcat
ccggctaaatttaaaaatactgtagaaaaaatattaaaaaataaaatttcactgccttct
gaactacaaaatagaattgatttaccattattatctcataatattaatcctgtttttagt
aaattaaaaacgtttttattagaaaaataa

DBGET integrated database retrieval system