KEGG   Buchnera aphidicola 5A: BUAP5A_203Help
Entry
BUAP5A_203        CDS       T00820                                 

Gene name
aceF
Definition
branched-chain alpha-keto acid dehydrogenase subunit E2 (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bap  Buchnera aphidicola 5A (Acyrthosiphon pisum)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bap00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BUAP5A_203 (aceF)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BUAP5A_203 (aceF)
   00020 Citrate cycle (TCA cycle)
    BUAP5A_203 (aceF)
   00620 Pyruvate metabolism
    BUAP5A_203 (aceF)
Enzymes [BR:bap01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BUAP5A_203 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
226501..227718
Genome map
AA seq 405 aa AA seqDB search
MKTVDIEVKMPDIGLEEVEIIEILVSINEKIAPEQGLITVEGDKTSMEIPSPISGIVKHI
FIKIGEKIKTDALIMRCEVENIDFHVKKKEEICLDNNVLNKVEKNFKKDIFFHATPLIRR
LARNLNINLYDVVGTGPKNRILKEDLDLYQSNIKENLIEEKNKINFGDSKKSKTKELELS
DIQKNIGNNLHRNWMNIPHVTQFDEVDITILEKFRQKYNNEKRNQKKTNENITILVFIIK
VVAYALEKFPIFNSSLNINNKKIILKKYINIGFAIDVNNDLFVPVLKDVNKKNIKQLSSE
LILLSEKARTRKLNIEDMTGGCFTISNLGGIGGSWFSPIINSPEVAILGISKSQIKPSWN
GKEFIPSLMLPLSLSYDHRVINGAYAARFITFISRVLSDMHFLIM
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaacagtggatatagaagtcaaaatgcctgatattggtttagaagaagtagaaata
attgaaatattagtaagtattaatgaaaaaatagcaccagaacaaggattaataactgtg
gaaggagataaaacttctatggaaataccttcacctatatcaggtattgtaaagcatatc
ttcattaaaattggcgaaaaaattaaaactgatgctcttatcatgagatgtgaagtggag
aatattgattttcatgtaaagaaaaaagaagaaatttgtttagataataatgttttaaat
aaggttgaaaaaaatttcaaaaaagatattttttttcatgcaactccattaataagacgt
ttagctcgaaatttaaatataaatttatacgatgttgttggtaccggacctaaaaatagg
attttaaaagaagatttagatctatatcaaagtaatattaaagagaatcttatagaagaa
aaaaataaaattaattttggtgattctaagaaatcaaaaacaaaagaattagaattaagt
gatatccagaaaaatattggtaataatttacatcggaattggatgaatatacctcatgtt
acacaatttgatgaagttgatattactatattagaaaagtttcgtcaaaaatataataac
gaaaagagaaatcaaaaaaaaacaaatgaaaatattacaattttagtttttataataaaa
gtagttgcatatgcattagaaaaattccctatttttaacagttcactaaatattaataat
aaaaaaattattttaaaaaaatatattaatatcgggtttgcaatagatgtaaataacgat
ttatttgttcctgttttaaaagacgtcaataaaaaaaatattaaacaattatcttctgaa
ttaatattgctatcagaaaaagcacgaacaagaaaattaaatattgaagatatgacagga
ggctgttttacaatatctaatttaggaggtattggaggaagctggttttcaccaattatc
aattcaccggaagtagcaattcttggtatttcaaaatctcagataaaaccgtcatggaat
ggaaaagaatttattccttctttaatgttaccattatctttatcttatgatcatcgtgta
ataaatggtgcttatgcagcgcgttttattacatttattagtagagttttatcagatatg
cattttttaattatgtag

DBGET integrated database retrieval system