KEGG   Buchnera aphidicola 5A (Acyrthosiphon pisum): BUAP5A_272Help
Entry
BUAP5A_272        CDS       T00820                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bap  Buchnera aphidicola 5A (Acyrthosiphon pisum)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bap00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BUAP5A_272 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BUAP5A_272 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BUAP5A_272 (trpA)
Enzymes [BR:bap01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BUAP5A_272 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(303082..303891)
Genome map
AA seq 269 aa AA seqDB search
MNRYQETFKRLSCLKEGCFIPFVVLGDPSLETSIKIIETLIKSGADALEIGIPFSDPLAD
GPTVQKSNLRALSKNNTFFEYFKILKQLRKKNKKLPIGILIYANLVYNQGIDNFYFQCFN
SGLDSVLIADVPIEESKIFYNIANKYKINPIFICPPDADADFLYKISLYAQGFIYVLSRP
GVTGIKNNTIALPRDFINKIKKYNSVPLLQGFGISNPKQIKEAISSGLSGVICGSAIINI
IEKYLNQEKKMIKEIKKFTHLLKLSTKLE
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgatatcaggaaacatttaaaagattatcttgcttgaaagaaggatgttttatc
ccttttgtagttttaggtgatccttctttagaaacatcaataaaaattattgaaacttta
ataaaaagtggtgcggatgctttagaaatcggtattccgttttcagatccattagctgat
ggaccaactgtgcaaaaatctaatttacgtgctttatctaaaaataatactttttttgaa
tattttaaaatattaaaacaattacgtaaaaaaaataaaaaattacctattggtattttg
atatatgcaaatcttgtatataatcaaggtattgataatttttattttcaatgctttaat
tctggtttagattctgtacttatagcagatgttccaattgaagaatcaaaaattttttat
aatatagcaaataaatataaaattaatcctatttttatctgccctcctgatgcagacgca
gactttttatataaaatttctttatatgcacaaggatttatttatgtattatctcgtcct
ggagtaaccgggattaaaaataatactattgcattgcctagagattttataaataaaata
aaaaaatataattctgtccctctattacaaggttttggtatttcaaatcctaaacaaata
aaagaagcaatatcatcaggcttatctggtgtaatatgtggttcagcaataataaatatt
attgaaaaatatttaaatcaagaaaaaaaaatgattaaagaaataaaaaaatttactcat
ttattaaaactttctactaaattagaataa

DBGET integrated database retrieval system