KEGG   Buchnera aphidicola 5A (Acyrthosiphon pisum): BUAP5A_299Help
Entry
BUAP5A_299        CDS       T00820                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bap  Buchnera aphidicola 5A (Acyrthosiphon pisum)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:bap00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BUAP5A_299 (pfkA)
   01230 Biosynthesis of amino acids
    BUAP5A_299 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BUAP5A_299 (pfkA)
   00030 Pentose phosphate pathway
    BUAP5A_299 (pfkA)
   00051 Fructose and mannose metabolism
    BUAP5A_299 (pfkA)
   00052 Galactose metabolism
    BUAP5A_299 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    BUAP5A_299 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    BUAP5A_299 (pfkA)
Enzymes [BR:bap01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BUAP5A_299 (pfkA)
Protein phosphatases and associated proteins [BR:bap01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     BUAP5A_299 (pfkA)
Messenger RNA biogenesis [BR:bap03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     BUAP5A_299 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
339552..340514
Genome map
AA seq 320 aa AA seqDB search
MIKKIGVLTSGGDAPGMNAAIRGVVRTALSERLEVFGIYDGYLGLYENRMVQLDRYSVSD
MINRGGTFLGSARFASFYQDKIRSIAVQNIKKRKIDALVVIGGDGSYIGAQKLTEMGIPC
ISIPGTIDNDVSGTDYTIGYFTALQTVVEAIDRLRDTSSSHQRISIVEVMGRHCGDLTLA
AAIAGGCEFIVLPEIDYKKEDLVIEIQAGIAKGKKHAIVAITEYICDVEELAQYIEKKTN
RETRATILGHIQRGGAPVVYDRILASRMGAYSVELLIKGYQGKCVGIQNEKMVFNDIKNA
LKNMKRTFKKDWLITAKKLY
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaaattggagttttaactagtggtggcgatgctccagggatgaatgccgca
attagaggggttgttagaacagcacttagtgaaagattagaagtatttggaatttatgat
ggatatttaggtctatatgaaaaccgtatggtgcaacttgatagatatagtgtatctgac
atgattaacagaggtgggacatttttagggtcagctagatttgctagtttttatcaagac
aaaatacgctcaattgcagtgcaaaatataaaaaaaagaaaaatagatgctcttgttgtc
attggaggtgatggttcttatataggagctcaaaaattaacagaaatgggtattccatgt
attagcattccaggtactatcgataatgatgtttcaggtactgattatacaataggttat
tttacagctttacaaacagtggttgaagctattgatcgattgcgcgacacttcttcttct
caccaacgtatttctattgtagaggtgatgggtagacattgtggagatttaacattagct
gcagctattgctggtggatgcgaatttattgttttaccagaaattgactataaaaaagaa
gatctagttatcgagattcaagctggcattgctaagggcaaaaaacatgctattgttgcg
ataactgaatacatttgtgatgtagaagaattagcacaatatattgaaaaaaaaactaat
cgagaaactagagcgacaattcttggacatatccaaagagggggtgcacctgtagtatat
gatcgtatattagcatcaagaatgggtgcatattcagttgaattattaataaaaggttat
cagggaaaatgtgttggaatacaaaatgaaaaaatggtttttaacgatataaaaaacgca
ctaaaaaatatgaaacgtacttttaaaaaagattggttgattactgctaaaaagttatac
taa

DBGET integrated database retrieval system