KEGG   Buchnera aphidicola 5A: BUAP5A_362Help
Entry
BUAP5A_362        CDS       T00820                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
bap  Buchnera aphidicola 5A
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:bap00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bap00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
408886..409818
Genome map
AA seq 310 aa AA seqDB search
MRNSLYKKNIISINDLQRNELELVLNKSAMLKRTPQPNLLKNKVIASCFFEASTRTRLSF
ETAIYRLGASIVGFSDGNNISLEKKGETLTDTISVISSYVDAIIIRHPQEGSARLAAEFS
NKKPIFNAGDGANQHPTQTLLDLFTIQETQNRLTQLNIAIVGDLKYGRTVHSLTQALAKF
KHNKFYFISPDALKMPNYINNMLDKKEIYWKRHNNIEEIISEIDILYMTRIQKERLDSTE
YANAKSKFVLRAAILKNARNNMKILHPLPRIDEIDRDVDYTPYAWYFKQAANGIYARQAI
LSLVLIEKHL
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
ttgagaaattctctatataaaaaaaatattatttcaattaatgatcttcaacgcaatgaa
ttagaattagttttaaataaatctgcaatgctaaagagaacaccacaacctaatttatta
aaaaataaagttattgccagttgtttttttgaggcatccactcgcactcgtttgtcattt
gaaactgcaatttatcgattaggggcttcgatagtagggttttctgatgggaataatatt
tctttagaaaaaaaaggagaaacattaacagacactatttcagtgattagttcttatgta
gatgcaattattattcgacatcctcaagaaggatctgcacgtttagctgcagaattttct
aataaaaaaccaatatttaatgcaggagatggagcaaatcaacatcctacacaaacacta
ttagatttatttactatacaagaaacacaaaatagattaactcaattaaatatagctata
gtcggagaccttaaatatggaagaacagtacattcattaacacaagcattagctaaattt
aaacacaataaattttattttatttcacctgatgctttaaaaatgccaaattatattaac
aatatgcttgataaaaaagaaatttactggaaaagacataataatattgaagaaataatt
tcagaaatagatattctttatatgactcgtattcaaaaagaacgtctcgattctactgaa
tatgccaatgcaaaatcaaaatttgtattgcgtgctgctattttaaaaaatgcacgtaat
aatatgaagatattacatcctttacctcgtatagatgaaatagatcgtgatgttgactat
accccttatgcttggtattttaaacaagcagcaaatggtatttatgcacgtcaagcaatt
ttatctttggtactaatagaaaaacatttataa

DBGET integrated database retrieval system