KEGG   Bacillus amyloliquefaciens subsp. plantarum CAU B946: BACAU_0022Help
Entry
BACAU_0022        CDS       T01692                                 

Gene name
recR
Definition
(RefSeq) Recombination protein recR
  KO
K06187  
recombination protein RecR
Organism
baq  Bacillus amyloliquefaciens subsp. plantarum CAU B946
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:baq00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BACAU_0022 (recR)
DNA repair and recombination proteins [BR:baq03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      BACAU_0022 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
30088..30684
Genome map
AA seq 198 aa AA seqDB search
MQYPEPISKLIDSFMKLPGIGPKTAVRLAFFVLGMKEDTVLDFAKALVNAKRNLTYCSIC
GHITDQDPCYICEDTRRDKSVICVVQDPKDVIAMEKMKEYNGQYHVLHGAISPMDGIGPE
DIKIPELLKRLQDDQVTEVILATNPNIEGEATAMYISRLLKPSGIKLSRIAHGLPVGGDL
EYADEVTLSKALEGRREL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgcagtatcctgaaccaatatcaaagctgattgacagctttatgaaattgccagggatc
ggaccgaaaacagcggttcgtctggctttttttgttctaggtatgaaagaagacacagta
ttggattttgctaaggcgcttgtcaatgcgaagcggaatctgacatattgctcgatttgc
ggacatattacagatcaggacccttgttatatatgtgaggacacaagaagggataagtct
gttatttgtgtcgtgcaggaccctaaggatgtgatcgcaatggagaaaatgaaggaatat
aacggccagtatcatgttcttcacggcgcgatttcaccaatggacggcatcggcccggag
gatattaagattccggagctgctgaaacgtcttcaggatgatcaagtgacagaagttatt
ctcgcaaccaaccctaatattgaaggggaagcaacagcgatgtatatatcaaggctgtta
aagccctcaggcatcaagctctcccgtattgcccacggtctgcccgtcggcggtgatttg
gaatatgctgatgaggtcactctttcaaaagctcttgaaggaagacgtgaattgtaa

DBGET integrated database retrieval system