KEGG   Bacillus amyloliquefaciens subsp. plantarum CAU B946: BACAU_0078Help
Entry
BACAU_0078        CDS       T01692                                 

Gene name
sul
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
baq  Bacillus amyloliquefaciens subsp. plantarum CAU B946
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:baq00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BACAU_0078 (sul)
Enzymes [BR:baq01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     BACAU_0078 (sul)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
86715..87572
Genome map
AA seq 285 aa AA seqDB search
MAQQTIEQPKLIHTKKGALSYKEKTLVMGILNVTPDSFSDGGKYDSTERALLHAAKMAEE
GAHIIDIGGESTRPGASLVSADEEMSRVIPVIERITSELDIPLSIDTYKASVADEAVKAG
ASILNDIWGAKGDPDMASVAAAHGVPIILMHNRMERNYNDLIPDMLADLMESVKIAAEAG
VTDENMILDPGIGFAKNYEDNLAVMNKLEVFSGLGYPLLLATSRKRFIGRVLDLPPEERA
EGTGATVCLGVQKGCDIVRVHDVKEIARMTKMMDAMLNKGGAHYG
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagcaaacaattgaacagcctaaactgattcatacaaaaaaaggcgctctgtcc
tataaagagaagacgctcgttatggggatattaaatgtaacgccagactccttctctgac
ggcggcaaatacgacagtacggaaagggcgcttctgcatgcggcgaagatggctgaagaa
ggggcgcatatcatagatatcggcggcgaatcgacaaggcccggcgcatcactcgtttcg
gctgatgaggaaatgtcacgagtcatccccgtcatagaacggattacaagcgagctggac
attccgctttcaatcgatacgtacaaagcgtccgtggcagacgaagcggtcaaagcggga
gcctctatccttaatgacatctggggggcgaaaggtgaccctgacatggcgtcagtagcc
gccgcacacggagttccgattatcttaatgcataatcgtatggaaagaaactataacgat
cttattcctgatatgcttgcagacttgatggaaagcgtaaaaattgccgcagaagccggc
gtcacagatgaaaacatgattctggatccggggatcggctttgcgaaaaactatgaggac
aatctggctgtcatgaacaagctggaggtgttcagcgggttagggtatccgctgctcctg
gcgacatcgagaaaaaggttcatcggccgtgtgcttgaccttccccctgaagaacgtgcc
gagggaacgggagcgacagtatgccttggcgtccaaaaaggctgcgacattgtgagggtg
cacgatgtcaaagagatcgcaagaatgactaagatgatggatgctatgctgaacaaagga
ggcgcgcattatggataa

DBGET integrated database retrieval system