KEGG   Bacillus amyloliquefaciens subsp. plantarum CAU B946: BACAU_0078Help
Entry
BACAU_0078        CDS       T01692                                 

Gene name
sul
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
baq  Bacillus amyloliquefaciens subsp. plantarum CAU B946
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:baq00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
86715..87572
Genome map
AA seq 285 aa AA seqDB search
MAQQTIEQPKLIHTKKGALSYKEKTLVMGILNVTPDSFSDGGKYDSTERALLHAAKMAEE
GAHIIDIGGESTRPGASLVSADEEMSRVIPVIERITSELDIPLSIDTYKASVADEAVKAG
ASILNDIWGAKGDPDMASVAAAHGVPIILMHNRMERNYNDLIPDMLADLMESVKIAAEAG
VTDENMILDPGIGFAKNYEDNLAVMNKLEVFSGLGYPLLLATSRKRFIGRVLDLPPEERA
EGTGATVCLGVQKGCDIVRVHDVKEIARMTKMMDAMLNKGGAHYG
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagcaaacaattgaacagcctaaactgattcatacaaaaaaaggcgctctgtcc
tataaagagaagacgctcgttatggggatattaaatgtaacgccagactccttctctgac
ggcggcaaatacgacagtacggaaagggcgcttctgcatgcggcgaagatggctgaagaa
ggggcgcatatcatagatatcggcggcgaatcgacaaggcccggcgcatcactcgtttcg
gctgatgaggaaatgtcacgagtcatccccgtcatagaacggattacaagcgagctggac
attccgctttcaatcgatacgtacaaagcgtccgtggcagacgaagcggtcaaagcggga
gcctctatccttaatgacatctggggggcgaaaggtgaccctgacatggcgtcagtagcc
gccgcacacggagttccgattatcttaatgcataatcgtatggaaagaaactataacgat
cttattcctgatatgcttgcagacttgatggaaagcgtaaaaattgccgcagaagccggc
gtcacagatgaaaacatgattctggatccggggatcggctttgcgaaaaactatgaggac
aatctggctgtcatgaacaagctggaggtgttcagcgggttagggtatccgctgctcctg
gcgacatcgagaaaaaggttcatcggccgtgtgcttgaccttccccctgaagaacgtgcc
gagggaacgggagcgacagtatgccttggcgtccaaaaaggctgcgacattgtgagggtg
cacgatgtcaaagagatcgcaagaatgactaagatgatggatgctatgctgaacaaagga
ggcgcgcattatggataa

DBGET integrated database retrieval system