KEGG   Bacillus amyloliquefaciens subsp. plantarum CAU B946: BACAU_0080Help
Entry
BACAU_0080        CDS       T01692                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
baq  Bacillus amyloliquefaciens subsp. plantarum CAU B946
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:baq00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
87924..88427
Genome map
AA seq 167 aa AA seqDB search
MNNTAYIGLGSNMGDREHYLRQAVAMLTRHYGVTVSKISSIYETDPVGYEDQDQFLNMAV
EVKTSLSPFELLDVTQSIEAELGRTREIRWGPRTADLDILLYNRENIETERLIVPHPRMY
ERLFVLAPLKEICPQADHITISAETNQEGVRVWKQKSGVGEFVHSES
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgaacaatacggcatatatcggcctcggttccaatatgggcgaccgtgaacattatttg
cgccaggcagtggccatgctcacccggcattatggcgtgacggtgtcaaagatatcctct
atatatgaaacagatcccgtcggttatgaggatcaggatcagtttctcaatatggcggtt
gaagtgaaaacgtcgttatctccttttgaacttctagatgtaacacagtccattgaagct
gaattaggcagaacgagagagattcgctggggaccgcggacggcagaccttgacattttg
ctgtataatcgtgaaaatattgaaacagagcggctgattgttccgcatccgagaatgtat
gagcgcttatttgtccttgcgccgttaaaagaaatatgtccgcaggcggatcatatcacg
ataagcgctgaaacaaaccaagaaggtgtaagagtatggaagcagaaatctggggtaggc
gaattcgtgcattcagaaagctga

DBGET integrated database retrieval system