KEGG   Bacillus amyloliquefaciens subsp. plantarum CAU B946: BACAU_0092Help
Entry
BACAU_0092        CDS       T01692                                 

Gene name
gltX
Definition
glutamyl-tRNA synthetase
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
baq  Bacillus amyloliquefaciens subsp. plantarum CAU B946
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:baq00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    BACAU_0092 (gltX)
Enzymes [BR:baq01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     BACAU_0092 (gltX)
Amino acid related enzymes [BR:baq01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   BACAU_0092 (gltX)
Transfer RNA biogenesis [BR:baq03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    BACAU_0092 (gltX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
112004..113455
Genome map
AA seq 483 aa AA seqDB search
MGNEVRVRYAPSPTGHLHIGNARTALFNYLFARSQGGKFIIRIEDTDKKRNIEGGEQSQL
NYLKWLGMDWDESVDVGGEYGPYRQSERNDIYKEYYEELLEKGLAYKCFCTEEELEKERE
EQIARGEMPRYSGKHRNLTQEEQEQFLAEGRQPSIRFRVPEGKIISFNDIVKGEISFESD
GIGDFVIVKKDGTPTYNFAVAIDDYLMKMTHVLRGEDHISNTPKQIMIFQAFGWDIPVFG
HMTLIVNESRKKLSKRDESIIQFIEQYDELGYLPEALFNFIGLLGWSPVGEEELFTREQF
IEIFDVNRLSKSPALFDMHKLKWVNNQYVKALDLDQVVELTLPHLQKAGKVGTELSAEEQ
EWVRKLISLYHEQLSYGAEIVELTDLFFKDEIEYNQEAKAVLEEEQVPEVLSVFAAKLEE
LEEFTPELIKASIKAVQKETGHKGKKLFMPIRVAVTGQTHGPELPQAIELIGRETAVRRL
KSI
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatgaagtacgcgttcgttatgcaccgagtccgaccggacatttgcatatcggt
aacgccagaacggcgctttttaactatttatttgcccgcagccaaggcggaaagtttatt
atccggattgaggatacggacaaaaagcgaaatattgaaggcggagagcaaagtcagctc
aactatttgaaatggctcggcatggactgggatgaaagtgtggatgtcggcggagaatac
ggcccgtaccgccagtctgagcgtaacgacatttacaaagagtactatgaagagcttctt
gaaaaagggcttgcttataaatgtttctgtacggaagaagaacttgaaaaagaacgtgaa
gagcaaatcgcccgcggggaaatgccgcgctattccggcaaacacagaaacctgactcag
gaagagcaggagcagtttttagccgaaggcagacagccgagcatccgtttccgcgtgccg
gaagggaaaatcatctcatttaacgatatcgtaaaaggcgagatttcttttgaatcagac
ggcatcggcgactttgtcatcgtcaaaaaagacggaacaccgacgtataactttgccgtc
gcgattgacgattacttaatgaaaatgacgcacgtgctccgcggtgaggatcacatttca
aatacaccgaaacagatcatgattttccaggcattcggctgggatattcctgtcttcgga
catatgacgcttatcgtaaacgaaagccgcaaaaaattaagtaaacgtgatgaatcaatt
atccagtttattgagcagtatgatgagctgggttacctgcctgaagcgctgtttaacttt
atcggacttctcggctggtctcccgtcggtgaagaagagcttttcacaagagaacaattc
attgaaatttttgatgtaaatcgtttgtctaagtcaccggctctgtttgatatgcataaa
ctgaaatgggtcaacaaccaatacgtcaaagcgctggatcttgatcaagtggttgagctg
accctgccgcacctgcaaaaagcaggaaaagtcggcactgagctttctgccgaagaacag
gaatgggttcgtaaattaatctctctttaccatgagcaattgagctacggcgctgaaatt
gtcgagcttactgatttgttctttaaagatgagatcgagtataatcaagaggcaaaagcc
gttctggaagaagaacaggtgcctgaagtgctcagcgtatttgctgcgaagcttgaagag
cttgaagaatttacgcctgagctgatcaaagcctcaatcaaagctgttcagaaagaaaca
ggccataaaggcaaaaagctgttcatgccgattcgtgtagcggttaccggtcagacacac
ggtccggagcttccgcaggccattgagctgatcggcagagaaacagccgtcagacgcctg
aaaagcatttaa

DBGET integrated database retrieval system