KEGG   Bacillus amyloliquefaciens subsp. plantarum CAU B946: BACAU_0140Help
Entry
BACAU_0140        CDS       T01692                                 

Gene name
rpmJ
Definition
50S ribosomal protein L36
Orthology
K02919  
large subunit ribosomal protein L36
Organism
baq  Bacillus amyloliquefaciens subsp. plantarum CAU B946
Pathway
Ribosome
Module
Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:baq00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    BACAU_0140 (rpmJ)
Ribosome [BR:baq03011]
 Ribosomal Proteins
  Mitochondria
   Large subunit
    BACAU_0140 (rpmJ)
  Bacteria
    BACAU_0140 (rpmJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
148811..148924
Genome map
AA seq 37 aa AA seqDB search
MKVRPSVKPICEKCKVIRRKGKVMVICENPKHKQKQG
NT seq 114 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtgagaccatcagttaaaccaatctgcgagaaatgtaaagttattcgcagaaaa
ggaaaagtaatggtgatctgtgaaaatccaaagcataaacaaaaacaaggataa

DBGET integrated database retrieval system