KEGG   Bacillus amyloliquefaciens subsp. plantarum CAU B946: BACAU_0222Help
Entry
BACAU_0222        CDS       T01692                                 

Gene name
ybgJ
Definition
glutaminase
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
baq  Bacillus amyloliquefaciens subsp. plantarum CAU B946
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:baq00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BACAU_0222 (ybgJ)
   00330 Arginine and proline metabolism
    BACAU_0222 (ybgJ)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    BACAU_0222 (ybgJ)
Enzymes [BR:baq01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     BACAU_0222 (ybgJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(245868..246851)
Genome map
AA seq 327 aa AA seqDB search
MKDMVRERLEKEELASLLQDWVEHYRPFSVNGKSANYIPALGEINDSQLGICILEPDGSM
IHAGEWNVPFTLQSISKVISFIAACMSRGIPYVLDRVDVEPTGDAFNSIIRLEIHKPGKP
FNPMINAGAITVASLLPGETAHNKLEYLFSVFEKLIGKRPHIHEEVFRSEWQTAHRNRAL
AYYLKETNFLEADVEETLEVYLKQCAMEGTTEDIALIGLILAHDGYHPIRREQVIPKDVA
KLAKALMLTCGMYNASGKYAAFVGVPAKSGVSGGIMALVPPSARREQPFHNGCGIGIYGP
AIDEYGNSLTGGMLLKHIAQEWELSIF
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatatggtcagagagcgccttgaaaaagaggaactggcttcacttttacaagat
tgggtcgagcattaccgaccgttttccgtcaatggaaaaagcgcaaattatatacccgcc
ctcggagaaatcaacgactctcagctgggcatttgcatattagagccggatggctcaatg
attcatgccggtgaatggaatgtgccgttcacattgcagagcatctcaaaagtcatcagc
tttattgccgcatgcatgtccagaggcattccttatgtgctcgatcgtgtggacgtggag
ccgacgggtgatgcgtttaattctatcatccggcttgaaatccataaacccgggaagccc
ttcaatccgatgatcaatgccggcgccattaccgtcgcctcgctgcttccgggtgaaacg
gcgcataataaattagaatatctcttttccgtttttgaaaaattaataggaaaacggcct
cacattcacgaggaggtcttccgttctgaatggcagaccgcgcatcggaacagagcgctc
gcctactatttaaaagaaacgaactttctcgaggcggatgtggaagaaacgcttgaagtg
tatttaaagcagtgcgccatggagggtacaaccgaggacatcgctttaatcggattgata
cttgcccatgacggctaccatccgatccgacgggaacaggtcattccgaaagatgtcgcg
aaactcgccaaagccctgatgctgacgtgcgggatgtacaatgcgtcaggcaaatatgcg
gctttcgtcggcgtcccggccaaaagcggggtatccggcggcatcatggcattggttccc
ccaagcgccagaagagagcagccttttcataacggctgcggcatcggcatttacggtccg
gccattgatgaatacggcaacagcctgaccggcggcatgctgctgaaacatatcgcacag
gagtgggagctcagtattttttaa

DBGET integrated database retrieval system