KEGG   Bacillus velezensis CAU B946: BACAU_0727Help
Entry
BACAU_0727        CDS       T01692                                 

Gene name
yfmT
Definition
(GenBank) YfmT
  KO
K21802  
vanillin dehydrogenase [EC:1.2.1.67]
Organism
baq  Bacillus velezensis CAU B946
Pathway
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:baq00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BACAU_0727 (yfmT)
Enzymes [BR:baq01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.67  vanillin dehydrogenase
     BACAU_0727 (yfmT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
764512..765969
Genome map
AA seq 485 aa AA seqDB search
MFQYEELNKQFIGGRWRDGSSRNVLENRNPYTQKVITSFRKATPDDVDAAYRAAALAKQE
WDKVNPFKKRAILEKAVSFIEEHEEAIIYLIMEELGGTRLKAEFEIGLVKNMIKEAATFP
VRMEGKILPSTIDGKENRLYRIPAGVAGVISPFNFPFFLSMKSVAPALGAGNGVVLKPHE
ETPICGGTLIAKIFEAAGVPDGLLNVIVTDIGEIGDSFVEHPVPRIISFTGSTGVGSYIG
QLAVKHFKKPLLELGGNSALIVLEDADLEYAVNAAVFSRFTHQGQICMSANRVLVHTSVY
DKFTELYEAKVSSLKVGDPMDPDTVIGPLINERQAEGLRRSVEKAIEEGAVPVLSGRFSG
TVAEPVILKDVKPEMSIAKEELFGPAVCIMPFETEDEAVSIANATPFGLSGAVHAANVER
GVEFAKRIETGMIHVNDTTINDEPNVAFGGEKQSGLGRLNGEWSLEEFTTLKWISVQHEK
RQFPY
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaatatgaagaactaaataagcagtttatcggcggccgatggagggatgggagc
agccggaacgtattggaaaacagaaatccttatactcaaaaagtcatcacctcattccga
aaagcgacgcctgatgacgtggatgcggcatatcgcgccgcggctcttgcgaaacaagaa
tgggacaaagtaaacccttttaaaaagcgggccattttggaaaaagccgtttctttcatt
gaagagcacgaagaagcgattatttacttaatcatggaggagcttggcggaacacggctg
aaggctgagtttgaaatcggacttgtcaaaaatatgataaaagaagccgcaacatttccg
gtgcggatggaagggaaaattctcccgtccacgattgacggaaaagaaaacaggctgtac
agaatacctgccggagtcgcgggggtaatcagcccgtttaatttcccgtttttcctttcg
atgaaatctgttgcgccggcacttggcgcggggaacggcgtcgtgctgaagcctcatgaa
gaaacgccgatctgcggcggaacgcttatcgcgaaaatttttgaagcggccggcgtaccg
gacgggctgctgaatgtcatcgtgacggatatcggggagatcggcgacagctttgttgag
catcccgtgccgcggataatctcatttacaggctcaaccggagtgggcagctatatcgga
cagcttgcggtcaaacactttaaaaaaccgctgttggagcttggcggaaacagcgcgctg
atcgtgcttgaggatgctgatcttgaatacgccgtcaatgcggccgtattcagccggttt
acgcatcaaggacagatctgtatgtcggcgaaccgcgtgctcgttcacacatctgtttat
gacaaatttacagagctttacgaagcgaaagtgtcatcgctgaaagtcggcgatccgatg
gaccctgatacggttatcggtcctttaatcaatgagagacaggcggaaggcctgagacgg
tctgtcgaaaaagcgatagaagagggagcggttccggtgctgtccggccgattcagcgga
acggtcgctgagcctgtcattttaaaagatgtgaaacctgagatgagcatcgcgaaggag
gagctgttcggaccggccgtctgtatcatgccgtttgaaacggaggatgaagcggtaagc
atcgcaaacgcgacaccgttcggtttaagcggagctgtgcatgcggcaaacgtggaacgg
ggcgttgagtttgctaagcggatcgaaaccggcatgattcacgtcaacgatacgaccatt
aatgatgaaccgaacgttgcgttcggcggcgagaaacaatcaggtctcggcaggctgaac
ggcgaatggagccttgaagaattcaccacgctgaaatggatttcggttcagcatgaaaaa
cgccaattcccatattaa

DBGET integrated database retrieval system