KEGG   Bacillus amyloliquefaciens subsp. plantarum CAU B946: BACAU_0915Help
Entry
BACAU_0915        CDS       T01692                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
baq  Bacillus amyloliquefaciens subsp. plantarum CAU B946
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:baq00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    BACAU_0915 (glpK)
Enzymes [BR:baq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     BACAU_0915 (glpK)
Exosome [BR:baq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BACAU_0915 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
976338..977828
Genome map
AA seq 496 aa AA seqDB search
METYILSIDQGTTSSRAILFNKEGKIVHSAQKEFTQHFPQPGWVEHNANEIWGSVLAVIA
TVISESGISADQIAGIGITNQRETTVVWDKDTGKPVYNAIVWQSRQTSGICEELREKGYN
DTFREKTGLLIDPYFSGTKVKWILDNVEGAREKAENGNLLFGTIDSWLIWKMSGGAAHVT
DYSNASRTLMFNIHELKWDDELLDILGVPKSMLPEVKPSSHVYAKTVDYHFFGKNIPIAG
AAGDQQSALFGQACFEEGMGKNTYGTGCFMLMNTGEKAITSDHGLLTTIAWGLDGKVEYA
LEGSIFVAGSAIQWLRDGMRMFQDSKESETYAERVDSADGVYVVPAFVGLGTPYWDSDVR
GSVFGLTRGTTKEHFIRATLESLAYQAKDVLDAMEADSGISLKTLRVDGGAVKNNFLMQF
QSDLLDVPVERPEINETTALGAAYLAGIAVGYWKDSTEIADQWNLDKQFKPEMEDEKRVE
LYGGWKKAVNAAMAFK
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggagacctatattttatcaattgaccaaggcacaacaagttcaagagcgattcttttt
aataaagaaggaaaaatcgtgcattccgctcaaaaggaattcacacagcatttccctcag
ccgggctgggtggagcacaatgcgaacgaaatctggggatcggtgctcgccgttatcgcg
actgtgatttccgagtccggaatcagcgctgatcaaattgccggcatcggcatcacgaac
caaagggaaacgacggtcgtatgggataaagataccggaaagccggtatacaatgcgatt
gtgtggcaatcgagacaaacatccggcatttgcgaagagcttcgtgaaaaaggatataat
gatacattcagagaaaaaacgggacttttgatcgacccttatttctcaggaacgaaagtc
aaatggattcttgacaatgtagaaggcgcgcgggaaaaagcggaaaacggaaatcttctg
ttcggaacgattgattcatggctcatctggaaaatgtccggaggcgcggcgcacgtaacg
gattattccaacgcttcaagaacgctgatgtttaatatccatgaattaaaatgggatgac
gagctgcttgatattttaggcgtgccgaaatccatgctgccggaagtgaaaccgtcttct
catgtgtacgcgaaaacggttgattatcatttcttcggtaaaaatattccgattgcggga
gcggccggagaccagcagtctgcgctgtttggtcaggcgtgctttgaagaaggcatgggg
aaaaacacatacggcacaggctgctttatgctgatgaataccggagaaaaagccatcact
tctgatcacggccttctgacgacaatcgcctggggattagacggaaaagtcgagtatgca
ctggaaggaagcatctttgtcgcaggttctgccatccaatggctgagagacggcatgcgg
atgtttcaggattcgaaagaaagcgagacatacgcagagcgtgtggattccgctgacggt
gtttatgtcgtgcccgctttcgtcggattgggcacaccgtactgggacagtgacgtgcgc
ggctcagttttcggcctgacacgcggaacgacgaaggagcattttatccgtgccacgctt
gaatctctcgcatatcaggcgaaagatgtgcttgatgccatggaggctgattcaggcatc
tctttaaaaacattgcgtgtagacggcggagcggtaaaaaataacttcctcatgcagttc
cagagcgacttgcttgatgtgccggtcgaacgtccggaaattaatgaaacgactgcgctc
ggtgccgcgtatttagccggaatcgctgtcggctactggaaggacagcactgaaatcgcc
gatcagtggaaccttgataagcaattcaaaccggaaatggaagatgaaaaacgcgttgaa
ttgtacggcggatggaaaaaagcagtaaatgcagctatggcttttaaataa

DBGET integrated database retrieval system