KEGG   Bacillus velezensis CAU B946: BACAU_0998Help
Entry
BACAU_0998        CDS       T01692                                 

Gene name
hemY
Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
baq  Bacillus velezensis CAU B946
Pathway
baq00860  Porphyrin and chlorophyll metabolism
baq01100  Metabolic pathways
baq01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:baq00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BACAU_0998 (hemY)
Enzymes [BR:baq01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     BACAU_0998 (hemY)
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     BACAU_0998 (hemY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO NAD_binding_9 HI0933_like Pyr_redox_2 MCRA Pyr_redox Lycopene_cycl Trp_halogenase FAD_binding_2 Thi4
Motif
Other DBs
NCBI-ProteinID: CCF04532
Position
1059741..1061174
Genome map
AA seq 477 aa AA seqDB search
MSGDKKHLVIIGGGITGLAAAFYMEKEIKEKQLPLEVTLIEAGPRAGGKIQTAHKDGYII
ERGPDSFLERKKSAPQLVKDLGLEHLLVNNATGQSYVLVNETLHPMPKGAVMGIPTKIAP
FISTGLFSVPGKARAALDFVLPASKPKEDQSLGEFFRRRVGDEVVENLIEPLLSGIYAGD
IDKLSLMSTFPQFYQTEQKHRSLILGMKKSRPQPSGQELTAKKQGQFLTLTTGLQTLVEE
LEKQLTLTKVMKGTKVTHIGREEKGYSVTLDNGKVLYAEGCIVTAPHKAAAKMLSDLPAV
SCLKDMHSTSVANVALGFPEGAVKMEHEGTGFVISRNSDFSITACTWTNKKWPHAAPEGK
TLLRAYVGKAGDESIVDLSDNEIIKIVMEDLKKVMKINGEPEMTCVTRWNESMPQYHVGH
KERIKEFRDALKASYLGVYATGASFEGVGIPDCIDQGKAAVYDSLAYLFETYQPPLS
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgagtggcgataaaaaacatctggtcatcatcggcggcggcataacgggattagccgcc
gccttctacatggaaaaagaaatcaaggaaaaacagctgccgcttgaggtcaccctgatc
gaagcgggcccgagagcgggcggcaaaattcagacggcgcataaagacggctacatcatt
gagcgggggccggattcttttttggaaaggaaaaaaagcgcgccgcagctcgttaaggat
ttggggcttgagcatctgctcgtcaacaatgcgactggccagtcttacgtgctcgtcaat
gagacgcttcatccgatgccgaagggcgcggtgatgggcattccgaccaaaatcgctccg
ttcatctccaccggtttattttctgtacccggaaaagcgcgggcggcgcttgactttgtc
ctgcctgcgagcaaaccgaaggaagatcagtctctgggtgaatttttccgcagacgcgtc
ggtgacgaagtcgttgagaatttaatagaaccgctattatcagggatttatgccggagat
attgataagctgagcctcatgtccacgtttccgcaattctatcagactgagcaaaagcac
agaagcctgattctcggtatgaaaaaatcacgtccgcagccttcgggacaggagctgacg
gccaaaaagcagggccagtttttaacgctgacgacagggcttcaaacgttggtggaggag
ctggaaaagcagcttacgctgacaaaggtgatgaaaggaacgaaagtcacccatatcggc
cgcgaggagaaaggatattccgtgacgcttgataacggcaaagtgctctatgcggaagga
tgcatagtgacagccccgcataaagccgcggcgaaaatgctttctgatctgccggcggtt
tcatgtctcaaagacatgcattctacgtccgttgccaacgtcgccttaggttttcctgag
ggagccgtcaaaatggagcatgaaggtacgggatttgttatctcaagaaacagcgatttc
tccatcacggcctgcacatggacgaataaaaaatggccgcacgcggcgccggagggcaaa
acacttctcagggcgtacgtcggaaaggccggagatgaatccatcgtagatctttcagat
aacgagatcattaaaatcgtaatggaagatttgaaaaaagtaatgaaaataaatggcgaa
ccggaaatgacctgtgtgacccgctggaacgaaagcatgccgcaataccatgtcggccat
aaggagcgcatcaaagagttcagagatgcgctgaaagcttcctatctgggcgtatacgcg
acgggcgcgtctttcgaaggggtgggcatccccgactgtatcgaccagggaaaagccgcc
gtatatgattcactcgcttatttatttgaaacgtaccagcctccgttatcgtaa

DBGET integrated database retrieval system