KEGG   Bacillus amyloliquefaciens subsp. plantarum CAU B946: BACAU_1010Help
Entry
BACAU_1010        CDS       T01692                                 

Gene name
aprE
Definition
peptidase S8/S53 subtilisin kexin sedolisin
Orthology
K01342  
subtilisin [EC:3.4.21.62]
Organism
baq  Bacillus amyloliquefaciens subsp. plantarum CAU B946
Brite
Enzymes [BR:baq01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.62  subtilisin
     BACAU_1010 (aprE)
Peptidases [BR:baq01002]
 Serine Peptidases
  Family S8: subtilisin family
   BACAU_1010 (aprE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1074740..1075888)
Genome map
AA seq 382 aa AA seqDB search
MRGKKVWISLLFALALIFTMAFGSTTSAQAAGKSNGEKKYIVGFKQTMSTMSAAKKKDVI
SEKGGKVEKQFKYVDAASATLNEKAVKELKKDPSVAYVEEDHVAQAYAQSVPYGVSQIKA
PALHSQGFTGSNVKVAVIDSGIDSSHPDLKVAGGASMVPSETNPFQDNNSHGTHVAGTVA
ALNNSVGVLGVAPSASLYAVKVLGADGSGQYSWIINGIEWAIANNMDVINMSLGGPSGSA
ALKAAVDKAVASGVVVVAAAGNEGTSGGSSTVGYPGKYPSVIAVGAVNSSNQRASFSSVG
SELDVMAPGVSIQSTLPGNKYGAYNGTSMASPHVAGAAALILSKHPNWTNTQVRSSLENT
TTKLGDAFYYGKGLINVQAAAQ
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
gtgagaggcaaaaaggtatggatcagtttgctgtttgctttagcgttaatctttacgatg
gcgttcggcagcacgacttctgcccaggctgcagggaaatcaaacggggaaaagaaatat
attgtcggatttaagcagacaatgagcacgatgagcgccgccaagaaaaaagatgtcatt
tctgaaaaaggcgggaaagtggaaaagcaattcaaatatgtagacgcagcttcagctaca
ttaaatgaaaaagctgtaaaagagctgaaaaaagaccctagcgtcgcttacgttgaagaa
gatcacgttgcacaggcgtacgcgcagtccgtgccttacggcgtatcacagattaaagcc
cctgctctgcactctcaaggcttcaccggatcaaatgttaaagtagcggttatcgacagc
ggtatcgattcttctcatcctgatttaaaggtagcaggcggagccagcatggttccttct
gaaacaaatcctttccaagataacaactctcacggaactcacgttgccggtacagttgcg
gctcttaataactcagtcggtgtattaggcgttgcgccaagcgcatctctttacgctgta
aaagttctcggcgctgacggttccggccagtacagctggatcattaacggaattgagtgg
gcgatcgcaaacaatatggacgttattaacatgagcctcggcggaccttctggttctgca
gcgttaaaagcggcagttgacaaagccgttgcttccggcgtcgtagtggttgcggcagcc
ggtaacgaaggcacttccggcggctcaagcacagtgggctaccctggtaaatacccttct
gtcattgcggtaggcgctgttaacagcagcaaccaaagagcatctttctcaagcgtaggt
tctgagcttgatgtcatggcaccaggcgtctctatccaaagtacgcttcctggaaacaaa
tacggcgcgtacaatggtacgtcaatggcatctccgcacgttgccggagcggctgctttg
attctttctaagcacccgaactggacaaacactcaagtccgcagcagtttagaaaacacc
actacaaaacttggtgatgctttctactacggaaaagggctgatcaacgtacaggcggca
gctcagtaa

DBGET integrated database retrieval system