KEGG   Bacillus velezensis CAU B946: BACAU_1013Help
Entry
BACAU_1013        CDS       T01692                                 

Gene name
yhfS
Definition
(GenBank) acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
baq  Bacillus velezensis CAU B946
Pathway
baq00071  Fatty acid degradation
baq00072  Synthesis and degradation of ketone bodies
baq00280  Valine, leucine and isoleucine degradation
baq00310  Lysine degradation
baq00362  Benzoate degradation
baq00380  Tryptophan metabolism
baq00620  Pyruvate metabolism
baq00630  Glyoxylate and dicarboxylate metabolism
baq00640  Propanoate metabolism
baq00650  Butanoate metabolism
baq00900  Terpenoid backbone biosynthesis
baq01100  Metabolic pathways
baq01110  Biosynthesis of secondary metabolites
baq01120  Microbial metabolism in diverse environments
baq01130  Biosynthesis of antibiotics
baq01200  Carbon metabolism
baq01212  Fatty acid metabolism
baq02020  Two-component system
Brite
KEGG Orthology (KO) [BR:baq00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BACAU_1013 (yhfS)
   00630 Glyoxylate and dicarboxylate metabolism
    BACAU_1013 (yhfS)
   00640 Propanoate metabolism
    BACAU_1013 (yhfS)
   00650 Butanoate metabolism
    BACAU_1013 (yhfS)
  Lipid metabolism
   00071 Fatty acid degradation
    BACAU_1013 (yhfS)
   00072 Synthesis and degradation of ketone bodies
    BACAU_1013 (yhfS)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BACAU_1013 (yhfS)
   00310 Lysine degradation
    BACAU_1013 (yhfS)
   00380 Tryptophan metabolism
    BACAU_1013 (yhfS)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BACAU_1013 (yhfS)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BACAU_1013 (yhfS)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BACAU_1013 (yhfS)
Enzymes [BR:baq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BACAU_1013 (yhfS)
Exosome [BR:baq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BACAU_1013 (yhfS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CCF04547
Position
complement(1077896..1078987)
Genome map
AA seq 363 aa AA seqDB search
MEAVITDAKRTIFARENGLLKDCLPEDLAAPLIRHLSRNMPEDIDEVLIGNATGRGGNLA
RLSALAAGLPLSVSGTTIDRQCGSGLDAVRVACHFVKAGAGSTYIAGGAESSSRSPFSSR
ARFSPEHIGDPDMGIAAEYTAQAYGVTRKMQDEYALLSYERSVKAHEDGLYRREILPCHG
FAADENMLKKRNMEPLIARAKPVFQSGGSVTAANSCGISDGAAAVCVMEEQKARSLGLKP
GLRFIGSAVSGVHPHYPSAAPVYAVKKLLKERDLSPDDIDIYEINEAFAVKICVFSQQLQ
VPYSKINVRGGALAVGHPYGASGAALITRLFYEAKRRPDARYAAAAIGSGGGVGLALLFE
VLT
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggaagctgtaattacggatgcgaagcggacgattttcgcccgggaaaacggcctgtta
aaagactgtctccccgaagatttggcagctccgctgatccgacatttgagccggaacatg
cccgaagacattgatgaagtcctgatcggaaacgcgacgggccgcggcgggaacctcgcc
cggctgtcagccttggccgccgggcttcctttgagcgtgtccggtacgaccatcgacagg
cagtgcggttccggattggacgccgtgagggtcgcgtgccactttgttaaagccggcgcg
gggagcacatacatcgcgggaggagcggagagcagcagccgttcccctttctcatcccgg
gcgcgcttttctcctgaacacatcggcgatcctgatatgggcatagcggccgagtatacg
gcacaggcttacggcgtaacgagaaagatgcaggacgaatatgcccttctcagctatgaa
cggagcgtcaaagcgcacgaagacggcttgtaccgccgggaaattctcccctgtcacgga
ttcgccgctgacgaaaacatgctgaaaaagcggaacatggagcctctcatcgcccgcgcc
aaacccgtctttcagtccggaggctctgtcaccgcggccaacagctgcggaatttctgac
ggggcggcggcagtttgtgtgatggaagaacaaaaagcgcggtctctcggtttaaagccg
ggattgcgttttatcggaagcgcggtaagcggcgtccatccgcattatccgtcagcagct
ccggtttatgccgtcaaaaagcttttgaaggaacgggacctgtcaccggatgatattgat
atatacgaaatcaacgaggcgtttgccgtcaaaatatgcgttttttcacagcagcttcaa
gtgccgtattctaaaataaatgtccggggcggcgctctggccgtcgggcatccgtacggg
gcttccggggcggcgcttatcacccggcttttttatgaagcaaaaagacgcccggatgcc
cgctacgcagcagcagcgatcggcagcggaggcggagtcggactggcgcttctctttgaa
gtgttaacgtaa

DBGET integrated database retrieval system