KEGG   Bacillus amyloliquefaciens subsp. plantarum CAU B946: BACAU_1053Help
Entry
BACAU_1053        CDS       T01692                                 

Gene name
asnB
Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
baq  Bacillus amyloliquefaciens subsp. plantarum CAU B946
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:baq00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1116406..1118247
Genome map
AA seq 613 aa AA seqDB search
MCGIAGWVDFQKQLVQEKHIMNNMIDTLSKRGPDDSNVWGEPHVLFGHKRLSVVDIEGGR
QPMACTHQEETYTIIYNGELYNTEELRKELQARGHRFERTSDTEVLLHSYIEWREECVDR
LNGIFAFAIWDEKRKRLFGARDRLGVKPFFYKEHGSSFLFGSELKAILAHPDVKARTDSG
GLAEVFGLGPSRTPGCGVFKGIHEVRPAHAFTFSKDGLSIWRYWNVKSEKHTDSFDETAA
HIRYLFQDAVTRQLVSDVPVCTFLSGGLDSSAITAIAAAHFEKQGRDPLHTYSIDYEENS
KFFKASAFQPNDDGPWIDKMTNAFGTQHHKCVITQDQLVEHLEESVLVRDLPGMADVDSS
LLWFCREIKKDFVVSLSGECADEIFGGYPWFHTAAEEDGFPWMRSTEERVTLLDEKWQKR
LNLREYVNARYEETIAETPLLDGETGTDKARRQLFYLNMLWFMTNLLDRKDRMSMGASLE
VRVPFADHRLVEYVWNIPWEMKMHGSREKGILRKALEGLLPEDILYRKKSPYPKTHHPKY
TQGVTEWLKTILQQKDSVLHTLLDRKKLEMLLETEGSSFQVPWFGQLMKGPQLIAHLAQI
HTWFEAYRIDIEE
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaattgcgggttgggtcgattttcaaaagcagctcgtccaagagaaacatatt
atgaacaatatgatagacactctttcaaaacgagggcctgatgattcaaacgtctgggga
gagccccatgttttattcggacataaaagactttcggtcgttgacattgaaggcggccgc
cagccgatggcctgcacgcatcaagaggaaacgtacaccatcatttataatggcgagctg
tataacacggaggaattgcggaaggagcttcaggcgaggggccaccgttttgagaggacc
tctgatacagaagtgctgctacacagctatattgagtggcgggaggagtgcgtggaccgc
ttgaacggtattttcgcttttgccatctgggatgaaaagcgaaagcggctcttcggggca
agagaccggctcggcgtcaaaccgtttttttataaagaacacggctcttcctttctgttt
gggtcggaattgaaagctatccttgctcatcctgatgtgaaagcccgcacagacagcggc
ggacttgcggaagtattcggactcgggccgtccagaactccgggctgcggggtgtttaaa
ggaattcacgaggtgcgtcccgcccatgcgttcactttctcaaaggacggtttgtccata
tggcgttattggaatgtaaagagcgaaaagcatacagacagcttcgatgaaaccgccgct
cacattcggtacttatttcaggatgcagtgacacgccagctcgtatctgacgtgccggtt
tgcacgtttttatcaggggggcttgattcgagcgcgataaccgcgatagccgccgctcat
tttgagaaacaaggaagagatccccttcatacttattcaattgattatgaggagaacagc
aaattttttaaagcgagcgcctttcagccgaatgatgacggcccgtggatcgataaaatg
acaaatgcattcggcacacagcatcataaatgcgtgattacgcaggatcagctggttgaa
catctggaggaatccgttctcgtcagagacctgccgggcatggctgatgttgattcatcg
cttttatggttctgccgggaaattaaaaaagattttgtcgtgagcctttccggagaatgc
gcggacgaaattttcggcggatatccgtggtttcacaccgcggcagaagaagacggattt
ccttggatgaggtcgactgaggagagggtcacgctcttggatgaaaagtggcaaaaacgg
ctgaatcttagagaatacgtgaatgcgagatatgaagaaaccattgcggaaacgccgctg
ctagacggtgagacgggaacagataaagcgagacggcagctgttctacttaaatatgctt
tggtttatgaccaatctgctcgaccgcaaagaccgcatgagcatgggcgcaagtcttgaa
gtacgggtgccgttcgccgaccacagacttgtggaatacgtttggaatattccttgggaa
atgaaaatgcatggcagccgggaaaaaggcattttgcggaaagcgcttgaaggactgctt
cctgaagatattttgtaccgcaaaaaaagcccttatccgaaaacgcatcacccgaaatac
acgcagggggtcacagaatggctgaaaacgattttgcaacagaaagattccgtgcttcac
accctgcttgacagaaagaagctggaaatgctgctggagacagaaggctcatcttttcag
gtgccgtggttcggccagctgatgaaaggcccgcagctgatcgcccatcttgcccagatc
catacatggtttgaggcgtaccgtatcgatatagaagaataa

DBGET integrated database retrieval system