KEGG   Bacillus amyloliquefaciens subsp. plantarum CAU B946: BACAU_1183Help
Entry
BACAU_1183        CDS       T01692                                 

Gene name
hemD1
Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
baq  Bacillus amyloliquefaciens subsp. plantarum CAU B946
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:baq00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BACAU_1183 (hemD1)
Enzymes [BR:baq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     BACAU_1183 (hemD1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1236664..1237482
Genome map
AA seq 272 aa AA seqDB search
MGKGLNGKRIAIGGSRKTEEITKLIEKQGGTAVIRSLQGTVYLAEDQMEPDVRTFAEQKA
DWVIFTTGIGTETLLSVSEKIGLKEEFLAAVHEAKIGCRGYKTYAALKKLGITPHASDED
GTTRGLIRSLERFDFKDKKVMIQLHGEKAPVLTEFLEKNGAEVFPVLPYQHIPPERETVD
KLMGELLNGEVDAVCFTTAIQVRSLFDYAKEKGSAKELQQAFEKHVLAAAVGKVTAEAIR
DEGVKRVLAPDIERMGAMIIELSRYYESLTLS
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaaggattgaacgggaaacggattgccatcggcggttcgcggaaaacagaagag
atcacaaaattaatagaaaagcagggcggaacggcggtcatccgttccctccaaggaacc
gtatacctggcggaggatcaaatggaacccgacgtaagaacatttgccgagcaaaaagcc
gactgggtgatattcaccacaggcatcggtacggaaacgttattgtcggtatcggaaaaa
atcggtctgaaagaagaatttttagcggccgttcatgaagcgaaaatcggctgcagaggc
tataaaacatatgcggccttaaaaaagctcggcatcacgccgcatgcctcagatgaagac
ggtacaacaagagggctgatccgctccttggaacgatttgactttaaagataaaaaagtt
atgatacagcttcatggcgaaaaagcgccggttttaacggagttccttgagaaaaacgga
gcggaggtattccctgttctgccgtatcagcatattccgcctgaaagggagacggtcgat
aaactgatgggagagctgttaaacggagaggtcgatgccgtatgttttacgacagccatt
caagtgcgctctctctttgattatgcaaaagaaaaaggatccgcaaaagaattgcagcag
gcattcgaaaaacatgtgcttgccgccgcagtcggcaaagtgacggctgaagcgatccgg
gatgaaggggtaaagagggtccttgctccggacattgagcggatgggagcgatgataatt
gaattatcccgttactatgaatctctgaccttgtcataa

DBGET integrated database retrieval system