KEGG   Bacillus velezensis CAU B946: BACAU_1270Help
Entry
BACAU_1270        CDS       T01692                                 

Gene name
proB
Definition
(GenBank) gamma-glutamyl kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
baq  Bacillus velezensis CAU B946
Pathway
baq00330  Arginine and proline metabolism
baq00332  Carbapenem biosynthesis
baq01100  Metabolic pathways
baq01130  Biosynthesis of antibiotics
baq01230  Biosynthesis of amino acids
Module
baq_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:baq00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BACAU_1270 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    BACAU_1270 (proB)
Enzymes [BR:baq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     BACAU_1270 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: CCF04804
Position
1313887..1314999
Genome map
AA seq 370 aa AA seqDB search
MKKQRIVVKIGSSSLTNSNGSIDEAKIKEHTEAISLLKENGHEVILITSGAVAAGFSALG
YPSRPVTIKGKQAAAAVGQTLLMQQYMDHLKRYGLTPAQILLTRNDFSKRERYRNAYATV
MELLERGVVPIINENDSTSVEELTFGDNDMLSALVSGLIHADQLMILTDINGLYDANPNE
NPDAKRFDYLNDITPELLGYAGSAGSKVGTGGMKSKLLAAQTALSLGVKVFIGTGSGREK
LMVILNGKGDGTYIGDKDLSSVNNTRQWIMFHSPISGEIIIDGGAEQAMIHNGSSLLPAG
VADVCGSFPKGAVVEVRGPGGIIGKGQTQYSSDEILEAKGKRSDQLSGTKQVEVIHRDDW
VNLFDEGEHK
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacaaagaattgttgtgaaaatcgggagcagctcgctcaccaacagtaacgga
agtattgatgaagcaaaaatcaaggaacatacggaagccatttctttattaaaagaaaac
gggcatgaagtgatcctcattacctcaggcgcggtggcagcgggtttttccgctctcggc
tatccgtcgcgacccgttacgataaaaggaaaacaggcagctgcagcagtcggccagacg
cttttaatgcagcaatatatggaccatttaaaaagatacggtctgacgccggcacaaatt
ttattaacaagaaatgatttctcaaaaagagagcggtacagaaatgcctatgccactgta
atggaactgttggagcgcggcgtcgtgccgattattaatgagaatgattccacatcagtc
gaagaactgacgttcggtgataacgacatgctgtcggcgcttgtaagcggtttgattcat
gcagaccaattaatgattctcacagacattaacgggctgtacgatgccaatccgaatgaa
aacccggacgcaaagcggtttgactatctgaatgacatcacacctgaattgctcggatat
gccgggtcagcaggctcaaaggtcggcaccggaggcatgaagtcaaaacttctcgccgcc
cagaccgcattgtcgctcggggtgaaggtgtttatcggaaccggctccggacgtgaaaaa
ctgatggtgattttaaacggaaaaggcgacggcacttatatcggcgataaagacctgtcc
tcagtgaataatacacggcaatggatcatgtttcattctccgatatcaggggaaatcatc
attgatgggggagcggagcaggcgatgatccataacgggtcaagtctcctcccggccggc
gtcgccgatgtctgcggcagttttccgaaaggagccgtagtggaagtcagagggcccggc
ggcattatcggcaaagggcagacgcagtactcatccgatgaaattttagaagccaaaggg
aagcggagcgaccagctttcaggaacgaagcaggtggaagtgattcacagagatgattgg
gtgaatttatttgacgagggggaacacaaatga

DBGET integrated database retrieval system