KEGG   Bacillus amyloliquefaciens subsp. plantarum CAU B946: BACAU_1270Help
Entry
BACAU_1270        CDS       T01692                                 

Gene name
proB
Definition
gamma-glutamyl kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
baq  Bacillus amyloliquefaciens subsp. plantarum CAU B946
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:baq00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BACAU_1270 (proB)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BACAU_1270 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    BACAU_1270 (proB)
Enzymes [BR:baq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     BACAU_1270 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1313887..1314999
Genome map
AA seq 370 aa AA seqDB search
MKKQRIVVKIGSSSLTNSNGSIDEAKIKEHTEAISLLKENGHEVILITSGAVAAGFSALG
YPSRPVTIKGKQAAAAVGQTLLMQQYMDHLKRYGLTPAQILLTRNDFSKRERYRNAYATV
MELLERGVVPIINENDSTSVEELTFGDNDMLSALVSGLIHADQLMILTDINGLYDANPNE
NPDAKRFDYLNDITPELLGYAGSAGSKVGTGGMKSKLLAAQTALSLGVKVFIGTGSGREK
LMVILNGKGDGTYIGDKDLSSVNNTRQWIMFHSPISGEIIIDGGAEQAMIHNGSSLLPAG
VADVCGSFPKGAVVEVRGPGGIIGKGQTQYSSDEILEAKGKRSDQLSGTKQVEVIHRDDW
VNLFDEGEHK
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacaaagaattgttgtgaaaatcgggagcagctcgctcaccaacagtaacgga
agtattgatgaagcaaaaatcaaggaacatacggaagccatttctttattaaaagaaaac
gggcatgaagtgatcctcattacctcaggcgcggtggcagcgggtttttccgctctcggc
tatccgtcgcgacccgttacgataaaaggaaaacaggcagctgcagcagtcggccagacg
cttttaatgcagcaatatatggaccatttaaaaagatacggtctgacgccggcacaaatt
ttattaacaagaaatgatttctcaaaaagagagcggtacagaaatgcctatgccactgta
atggaactgttggagcgcggcgtcgtgccgattattaatgagaatgattccacatcagtc
gaagaactgacgttcggtgataacgacatgctgtcggcgcttgtaagcggtttgattcat
gcagaccaattaatgattctcacagacattaacgggctgtacgatgccaatccgaatgaa
aacccggacgcaaagcggtttgactatctgaatgacatcacacctgaattgctcggatat
gccgggtcagcaggctcaaaggtcggcaccggaggcatgaagtcaaaacttctcgccgcc
cagaccgcattgtcgctcggggtgaaggtgtttatcggaaccggctccggacgtgaaaaa
ctgatggtgattttaaacggaaaaggcgacggcacttatatcggcgataaagacctgtcc
tcagtgaataatacacggcaatggatcatgtttcattctccgatatcaggggaaatcatc
attgatgggggagcggagcaggcgatgatccataacgggtcaagtctcctcccggccggc
gtcgccgatgtctgcggcagttttccgaaaggagccgtagtggaagtcagagggcccggc
ggcattatcggcaaagggcagacgcagtactcatccgatgaaattttagaagccaaaggg
aagcggagcgaccagctttcaggaacgaagcaggtggaagtgattcacagagatgattgg
gtgaatttatttgacgagggggaacacaaatga

DBGET integrated database retrieval system