KEGG   Bacillus amyloliquefaciens subsp. plantarum CAU B946: BACAU_1503Help
Entry
BACAU_1503        CDS       T01692                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
baq  Bacillus amyloliquefaciens subsp. plantarum CAU B946
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:baq00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    BACAU_1503 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BACAU_1503 (pyrB)
Enzymes [BR:baq01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     BACAU_1503 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1587393..1588307
Genome map
AA seq 304 aa AA seqDB search
MNHLTAISELSAAEITELLREAKAIKEGAVRPDLAGKFVANLFFEPSTRTRFSFEVAEKK
LGMNVLSLDGTSTSVQKGESLYDTVKTLESIGADVCVIRHSTDEYYKDLTGRVNIPVLNA
GDGCGQHPTQSLLDLMTIQEEFETFQGLTVSIHGDIKHSRVARSNAEVLTRLGARVLFSG
PPQWQDEKNAFGTCVQTDEAIQASDVVMLLRIQNERHQTEADQKGYLEAYGLTEKRAQSM
KRHAIIMHPAPVNRGVEIDTTLVECGKSRIFKQMENGVYIRMAVLKRALQTNVKRGEAAY
VLSH
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaatcatttaacggcgatatctgaactgagcgcggctgaaattacagaactgctgcga
gaggcaaaagcgataaaagagggtgcagtccgtcccgatctcgcgggaaaattcgttgcg
aatctgttttttgaaccgagcacgagaacgcggttcagctttgaagtggcggaaaagaaa
ctcgggatgaacgtgctcagcttagacggcacgagcacaagcgttcaaaaaggcgagtcc
ttatacgacacggtcaaaacactggaatcaatcggagcggacgtctgcgtcatcaggcac
agcacggatgaatattacaaagatctgaccggcagagtcaatattccggtcttaaacgca
ggagacggctgcggacagcacccgacccagtcattgcttgatttaatgacgattcaagag
gaatttgagacctttcagggcctgacggtttccattcatggcgatatcaaacacagcaga
gtggcaaggtcaaatgccgaggtgctgacaaggctcggcgcacgtgtgctgttttccggg
ccgccgcagtggcaggatgagaaaaacgccttcggcacctgtgttcagacggatgaggcc
atacaagcttcagatgtcgtcatgctgctccgcatccaaaatgaaaggcatcagacagaa
gccgaccaaaaaggctacctggaagcatacgggctgaccgaaaagcgggcgcagagcatg
aagcggcatgctatcatcatgcatcccgcaccggtgaacagaggagtcgaaattgacaca
acattagtggaatgcggaaaatcaagaatctttaaacagatggaaaatggtgtgtatatc
agaatggcagtcttaaaaagagcactgcaaaccaatgtgaaaaggggagaagcggcttat
gtcttatctcattaa

DBGET integrated database retrieval system