KEGG   Bacillus amyloliquefaciens subsp. plantarum CAU B946: BACAU_1522Help
Entry
BACAU_1522        CDS       T01692                                 

Gene name
gmk
Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
baq  Bacillus amyloliquefaciens subsp. plantarum CAU B946
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:baq00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BACAU_1522 (gmk)
Enzymes [BR:baq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     BACAU_1522 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1609189..1609803
Genome map
AA seq 204 aa AA seqDB search
MKERGLLIVLSGPSGVGKGTVRQAIFSQQDTKFEYSISVTTRNPREGEVDGVDYFFKSRD
EFERMIENNKLLEWAEYVGNYYGTPVDYVEQTLQEGKDVFLEIEVQGALQVRNAFPEGLF
IFLAPPSLSELKNRIVTRGTETDDLIENRMNAAKAEIEMMDAYDYVVENDDIQTACDKIN
AIVLAEHLKRERVAPRYKKMLEVE
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaagagggttattaatcgttctctcaggtccctccggagttggaaaaggaacg
gttcggcaagcaatattttcacaacaggacacgaaatttgaatactcaatttcagtcacg
acgagaaacccgagagagggcgaggtcgacggcgtcgattatttctttaaatccagagat
gaattcgagcgcatgattgaaaacaacaaactgcttgagtgggcagaatatgtcggcaac
tattacggtacgcccgttgattatgtcgaacagacgcttcaagaaggaaaagacgtcttc
ttagagattgaagtgcagggcgcgctccaagtgcggaatgcatttccggaaggcctgttt
atcttcttagcgccgccgagtctttctgagctgaaaaacagaatcgtgacaagagggact
gaaaccgacgatttaatcgaaaacagaatgaatgccgcaaaagctgaaatcgaaatgatg
gacgcgtatgattatgtcgttgaaaacgacgatatccaaacggcttgtgataagattaac
gcaatcgttctcgccgagcacttaaaacgtgaacgcgttgctccgagatataagaaaatg
ctggaggtagaataa

DBGET integrated database retrieval system