KEGG   Bacillus amyloliquefaciens subsp. plantarum CAU B946: BACAU_1710Help
Entry
BACAU_1710        CDS       T01692                                 

Gene name
adh1
Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
baq  Bacillus amyloliquefaciens subsp. plantarum CAU B946
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:baq00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BACAU_1710 (adh1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BACAU_1710 (adh1)
  Lipid metabolism
   00071 Fatty acid degradation
    BACAU_1710 (adh1)
  Amino acid metabolism
   00350 Tyrosine metabolism
    BACAU_1710 (adh1)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BACAU_1710 (adh1)
   00626 Naphthalene degradation
    BACAU_1710 (adh1)
Enzymes [BR:baq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BACAU_1710 (adh1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1861915..1862931)
Genome map
AA seq 338 aa AA seqDB search
MKAVVATKDKSIAIVQKELRPLRHGEAKVKMEYCGVCHTDLHVKNADFGDVTGVTLGHEG
IGIVTEVGEGVTSLKKGDRVSIAWMFESCGRCEYCLTGRETLCRDVKNAGYTVDGAMAEE
AIVAVDYAIKVPENLDPAAASSITCAGVTTYKAVKVSEIKPGQWIGVFGVGGLGNLAVQY
AKNVFNAKVIAFDISDEKLNFAKSLGADAVVNSLNEDPVAKAKEVTNDSGLDAAVITAVS
KTPFNQAIDVVKAGARVVAVGLPVDKMDLDIPRLVLDGIQVVGSLVGTREDLKEAFQFAA
DGKVVPKVTKRPIEDVNDIFEEMEQGKVTGRMVIDFTS
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagcagtagtagcaacaaaagacaaaagtatagcgatcgtacaaaaagaattacgt
cctttgcggcatggtgaagccaaagttaagatggaatactgcggtgtatgtcatactgac
ttgcatgttaaaaatgctgatttcggggatgttaccggcgtcactttaggtcatgaggga
ataggcattgtgactgaggttggtgaaggcgtaacaagcctgaaaaagggcgaccgcgtc
tctattgcctggatgtttgaaagctgcggccgctgcgaatattgcttaacaggccgtgaa
accttgtgccgggatgtaaaaaatgccggctatacagttgacggcgcaatggctgaagaa
gcaatcgtagcggttgattacgcaataaaggtgccggaaaatttagatcctgcagcagca
agcagcattacttgtgcaggtgtaacaacttataaagcggttaaagtcagtgaaattaaa
ccaggtcaatggatcggtgtatttggagtcggcggtttaggcaacttggctgttcaatat
gcaaaaaacgtctttaacgctaaagtgattgctttcgacattagcgatgaaaaattgaat
tttgctaagagcttaggcgctgatgcggttgtaaacagtttaaacgaagaccccgtcgct
aaggcaaaagaagtgactaacgattcagggcttgatgctgcggtcatcacggctgtctct
aaaacccctttcaatcaagcgattgatgttgtaaaagcaggagctcgcgtagtcgccgtc
ggtttaccggtggacaaaatggatttagatattccccgtctcgtgttagatggaattcag
gtagtaggttcattagtgggtaccagagaagacctgaaggaagcttttcaatttgctgca
gacggtaaagttgtacctaaagttacaaaacgcccgattgaagatgtgaatgatattttt
gaagaaatggagcaaggcaaagtgaccggccgcatggttatcgattttacttcctaa

DBGET integrated database retrieval system