KEGG   Bacillus amyloliquefaciens subsp. plantarum CAU B946: BACAU_1766Help
Entry
BACAU_1766        CDS       T01692                                 

Gene name
bglC
Definition
glycoside hydrolase family protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
baq  Bacillus amyloliquefaciens subsp. plantarum CAU B946
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:baq00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BACAU_1766 (bglC)
Enzymes [BR:baq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     BACAU_1766 (bglC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1912439..1913938)
Genome map
AA seq 499 aa AA seqDB search
MKRSISIFITCLLITVLTMGGLQASPASASGTKTPAAKNGQLSIKGTQLVNRDGKAVQLK
GISSHGLQWYGDFVNKDSLKWLRDDWGITVFRAAMYTADGGYIDNPSVKNKVKEAVEAAK
ELGIYVIIDWHILNDGNPNQHKEKAKEFFKEMSSLYGNTPNVIYEIANEPNGDVNWKRDI
KPYAEEVISVIRKNDPDNIIIVGTGTWSQDVNDAADDQLKDANVMYALHFYAGTHGQSLR
DKANYALSKGAPIFVTEWGTSDASGNGGVFLDQSREWLNYLDSKNISWVNWNLSDKQETS
SALKPGASKTGGWPLTDLTASGTFVRENILGNKDSTKERPETPAQDNPAQENGISVQYKA
GDGGVNSNQIRPQLHIKNNGNATVDLKDVTARYWYNAKNKGQNFDCDYAQIGCGNLTHKF
VTLHKPKQGADTYLELGFKTGTLSPGASTGNIQLRLHNDDWSNYAQSDDYSFFQSNTFKT
TKKITLYHQGKLIWGTEPN
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgaaacggtcaatttctatttttattacgtgtttattgattacggtattgacaatgggc
ggcttgcaggcttcgccggcatctgcatcagggacaaaaacgccagcagccaagaatgga
cagcttagcataaaaggaacacagctcgtaaaccgggacggcaaagcggtacaattgaaa
gggatcagttcacatggattgcaatggtatggcgattttgtcaataaagacagcttaaaa
tggctgagagacgattggggcataaccgttttccgcgcggcgatgtataccgcagatggc
ggttatattgacaacccttccgtgaaaaataaagtaaaagaagcggttgaagcggcaaaa
gaacttgggatatatgtcatcattgactggcatatcttaaatgacggcaacccaaaccaa
cataaagagaaggcaaaagaattttttaaggaaatgtcaagtctttacggaaacacgcca
aacgtcatttatgaaattgcaaacgaaccaaacggtgatgtgaactggaagcgggatatt
aaaccgtatgcggaagaagtgatttccgttatccgcaaaaatgatccagacaacatcatc
attgtcggaaccggtacatggagccaagatgtgaatgatgcagccgatgatcagctaaaa
gatgcaaacgtcatgtacgcgcttcatttttatgccggcacacacggccaatctttacgg
gataaagcaaactatgcactcagtaaaggagcgcctattttcgtgacggaatggggaaca
agcgacgcgtctggaaatggcggtgtattccttgaccagtcgcgggaatggctgaattat
ctcgacagcaagaacatcagctgggtgaactggaatctttctgataagcaggaaacatcc
tcagcgttaaagccgggagcatctaaaacaggcggctggccgcttacagatttaactgct
tcaggaacattcgtaagagaaaacattctcggcaacaaagattcaacgaaagaacgccct
gaaacgccagcacaagataaccccgcacaggaaaacggcatttctgtacaatacaaagca
ggggatgggggtgtgaacagcaaccaaatccgcccgcagcttcacataaaaaataacggc
aatgcgacggttgatttaaaagatgtcactgcccgttactggtataacgcgaaaaacaag
ggccaaaactttgactgtgactacgcgcagattggatgcggcaatctgacccacaaattt
gtgacgctgcataaacctaagcaaggtgcagatacctatctggaactgggttttaaaaca
ggaacgctgtcaccgggagcaagcacagggaatattcagcttcgtcttcacaatgatgac
tggagtaattatgcacaaagcgacgattattcctttttccaatcaaatacgtttaaaaca
acgaaaaaaatcacattatatcatcaaggaaaactgatttggggaacagaacccaattag

DBGET integrated database retrieval system