KEGG   Bacillus amyloliquefaciens subsp. plantarum CAU B946: BACAU_1912Help
Entry
BACAU_1912        CDS       T01692                                 

Gene name
odhB
Definition
dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
baq  Bacillus amyloliquefaciens subsp. plantarum CAU B946
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:baq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BACAU_1912 (odhB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BACAU_1912 (odhB)
  Amino acid metabolism
   00310 Lysine degradation
    BACAU_1912 (odhB)
Enzymes [BR:baq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BACAU_1912 (odhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2118664..2119911)
Genome map
AA seq 415 aa AA seqDB search
MAEIKVPELAESISEGTIAQWLKQPGDYVEQGEYLLELETDKVNVELTAEESGVLKEVLK
DSGDTVQVGEIIGTITEGAGESSAPAPSESAPANEQTKEEAKAEPAAQEVSQEAQSEAKS
RTVASPAARKLAREKGIDLSQIPTGDPLGRVRKQDVEAYEKPASKPAAQPKQQAQKTQQS
FDKPVEVQKMSRRRQTIAKRLVEVQQTSAMLTTFNEVDMTAVMNLRKRRKDQFLEQNDVK
LGFMSFFTKAVVAALKKFPLLNAEIQGDELIVKKFYDIGIAVAAEEGLVVPVVRDADRLT
FAGIEREIGELAKKARNNKLTLGELQGGSFTITNGGTFGSLMSTPILNSPQVGILGMHKI
QLRPVAIDAERSENRPMMYIALSYDHRIVDGKEAVGFLVTIKNLLEDPEQLLLEG
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaattaaggtacctgaattagcagaatcaatctcagaaggaacgatagcccaa
tggttaaagcagcccggtgattatgtagaacagggtgagtacttgcttgaactggagacg
gacaaagtaaatgttgaattgacagcagaagaatcgggtgttctaaaagaggtattgaaa
gattcgggtgataccgtccaagtaggagaaattatcggtaccattacagaaggcgctggc
gaaagttctgcacccgccccttcagaaagtgctccagccaatgaacaaacgaaagaggaa
gcaaaagctgaacctgctgcacaagaagtcagccaggaagcacaatcagaagcgaaatcc
agaacggtagcgtctccggctgcacgcaagctggcaagggaaaaagggattgatctatca
caaattccgacgggggacccgcttggccgcgtgcgcaaacaagatgtggaagcttatgaa
aaaccggcttcaaaacctgcggcacagccgaaacagcaggctcaaaaaacacagcaaagc
tttgacaaacctgtcgaagtgcaaaaaatgtcccgccgcagacagacgatcgcgaaacga
ttggttgaagtgcagcagacttctgcgatgctgactacatttaacgaagttgacatgacg
gccgttatgaatctaagaaaacgccgtaaagaccaattccttgagcaaaacgatgtaaaa
ctcggtttcatgtcgttctttacaaaagccgtcgtggctgcattgaaaaaattcccgctc
cttaacgctgaaattcaaggcgatgagctgatcgtgaaaaaattctatgacatcggtatc
gctgtcgcggctgaagaagggcttgtcgtcccagtcgtacgtgacgctgaccgcctgacg
tttgccggcattgaaagagagatcggcgaacttgcgaaaaaagcgcgaaacaataaatta
acattaggtgagctgcaaggaggctccttcacgatcacaaacggaggtacattcggatcg
cttatgtcaacaccgatcctaaacagccctcaggtcgggatcttaggtatgcacaaaatt
cagctgcgcccagtagcaattgatgcggagcgctctgaaaaccgtccgatgatgtacatc
gctttatcatatgatcacagaattgtagatggtaaagaagcggtcgggttccttgtcacc
attaaaaacctgcttgaagatccggaacagctgctgctggaaggataa

DBGET integrated database retrieval system