KEGG   Bacillus amyloliquefaciens subsp. plantarum CAU B946: BACAU_1936Help
Entry
BACAU_1936        CDS       T01692                                 

Gene name
gba
Definition
glucosylceramidase
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
baq  Bacillus amyloliquefaciens subsp. plantarum CAU B946
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:baq00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:baq00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2141326..2142804)
Genome map
AA seq 492 aa AA seqDB search
MFFKKSLHMTLVFLMFFFFISSSTEAEVYAADRKASDKNKVRVWFSSEKDPASRTWYDGP
LEVKYALDEQTPLTWTKKKASDSAAVYIDPSRRYQSVLGVGSSLEESTIHNLSKMTPAKR
KEVLKKLVDPKDGIGMDVMRITIGTSDFTAQEFYTYDDMPEGQTDPKLRHFSIQEDIDLH
ITATIKEALAINPELKIIASPWSPPAWMKTNENLKRGKLKDKYIGALAVYFRKFIEAYEK
QGIPIYAMTLQNEPLLEIDYPSMYMPPSQQRKLAIAVKKELKKHIIDTKIWIYDHNASGA
WNYIPPILDDKKGNRAADGIAFHDYDGDLSVMSEIGKRYPDQSIHLTERSVWGTAGADRI
AQYFRNGASSYNAWVTMLDSQIKTHHWIGTPDPTLFIQDAKNPDRYWHIPIFHMTGNFSK
FIERGAKRIESNYGSKNTVSNVSFLNPDQSIVTVVINQTSSEQKFHVVSENRQFEAVIPA
KTVATYKWQHKK
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgttttttaaaaaaagtctgcacatgaccttggtttttcttatgtttttctttttcata
tcaagcagcacggaagccgaagtgtatgcggctgatcggaaggcttcagacaaaaacaaa
gtaagggtgtggttcagttctgaaaaagatccggcttcccgtacgtggtatgacgggccg
ctggaagtgaaatacgccttagacgaacaaacaccgcttacatggacaaaaaagaaggct
tctgactccgccgccgtgtatattgatccgtcgcgccgctatcaaagtgtgttgggcgta
ggatcgtccctggaagaatccacaatccataatttatcaaaaatgacacccgcaaaaaga
aaagaagtgctgaaaaaactggttgatcccaaagatggtatcggcatggacgttatgcgc
ataacgatcgggacatctgattttacggcacaggaattttatacgtatgacgatatgcct
gaaggccaaacagatcctaagctccgtcatttctcgatccaagaggatattgatttacac
attacagcaaccatcaaggaagcgctggcgataaatccggaactgaaaatcattgcctca
ccgtggagcccgccggcttggatgaaaacgaatgaaaacctcaagcggggaaagctgaaa
gataaatatatcggcgcactggccgtttacttccgcaaatttattgaggcgtacgaaaaa
cagggaattccgatttatgcgatgacccttcaaaatgaacctttgctggaaatcgactat
ccgagcatgtacatgccgccgtctcagcagcgcaaactggcgatagccgtgaaaaaagaa
ttgaaaaaacacataattgacacgaaaatttggatttatgatcacaatgcgagcggggcg
tggaactatattccgccgattttagatgataaaaaaggaaaccgggcggcagacggcatc
gcttttcacgattatgacggtgacctttctgtcatgtcggaaatcggaaagagatatcct
gatcaatctattcacttaacggagcggtctgtctgggggacggcaggggcggatcggatc
gcacagtatttccgcaacggcgcgtcgagctacaatgcgtgggtgacgatgctcgacagt
caaattaagacgcatcattggataggcaccccggacccgacgctgtttattcaggatgct
aaaaaccctgaccgctattggcatatcccgatctttcatatgacaggcaacttttcaaaa
tttatcgagcgcggagccaaacggatagaaagtaattacggctccaaaaacacagtctcg
aatgtatcgttccttaatcctgatcaatccattgtgacagtcgtaatcaaccagacatct
tcagaacaaaaattccatgtcgtttcagaaaatcggcagtttgaagccgtcatcccggct
aaaaccgtcgccacctacaaatggcagcacaaaaagtaa

DBGET integrated database retrieval system