KEGG   Bacillus velezensis CAU B946: BACAU_2087Help
Entry
BACAU_2087        CDS       T01692                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
baq  Bacillus velezensis CAU B946
Pathway
baq00260  Glycine, serine and threonine metabolism
baq00400  Phenylalanine, tyrosine and tryptophan biosynthesis
baq01100  Metabolic pathways
baq01110  Biosynthesis of secondary metabolites
baq01130  Biosynthesis of antibiotics
baq01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:baq00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BACAU_2087 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BACAU_2087 (trpA)
Enzymes [BR:baq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BACAU_2087 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth BtpA Ste50p-SAM
Motif
Other DBs
NCBI-ProteinID: CCF05621
Position
complement(2269785..2270582)
Genome map
AA seq 265 aa AA seqDB search
MFNLRDSEKLFIPFITAGDPLPDISVELAISLQNAGASALEIGVPYTDPLADGPVIQRAS
KRALENGMNIVKAIELGGKMKKNGVHIPIILFTYYNPVLQLEKEYFFALLRENDIDGLLV
PDLPLEESALLQMTCKKENIAYISLVAPTSEDRLKIITEQACGFVYCVSSLGVTGVRSEF
DPSVYSFIRKVKEFSSVPVAVGFGISNRKQVDGMNEISDGVVVGSALVKKVEELKTKLVN
PGTRADALLEFEEYAKTFGRLYSVK
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgtttaatctgcgagattctgaaaaattgtttatcccttttatcacagcgggcgatccg
cttcctgacatttctgttgaactggcaatatcattacagaatgcaggcgcttctgccctt
gaaatcggcgttccttacacagatccgcttgcggacggacccgtcatacaacgggcttca
aaacgggctctggaaaacggaatgaatatcgtaaaagccattgaacttggcggcaaaatg
aaaaaaaacggcgttcatattccaattatcctctttacgtattataatcctgtgttacaa
ttagaaaaagaatactttttcgctttactgcgggaaaacgacatagacggcctgcttgta
cccgaccttccattagaggaaagcgcccttttgcaaatgacatgcaaaaaggagaacatc
gcttatatctcgctggttgcgccgacaagtgaagaccgtttgaaaataattactgaacag
gcctgcggctttgtgtattgtgtatcctctttaggagtgacgggcgtacgcagcgaattc
gatccgtctgtatactctttcatccgtaaggtgaaagaattcagctctgttccggtggcg
gtcggttttggcatttcaaaccgcaaacaggttgacgggatgaatgaaatatctgacggt
gtcgttgtcggcagcgcgcttgtcaaaaaagttgaagagcttaaaacaaagcttgtgaat
cccggcacaagagctgatgcgcttcttgaatttgaagaatacgcgaagacgttcggacga
ctgtacagtgtaaaatga

DBGET integrated database retrieval system